Navigation

  • Page 1

    Operation andProgrammingManual9/Series CNCGrinderAllen-Bradley

  • Page 2

    Because of the variety of uses for the products described in thispublication, those responsible for the application and use of this controlequipment must satisfy themselves that all necessary steps have been takento assure that each application and use meets all performance and safetyrequirements...

  • Page 3

    9/Series GrinderOperation and Programming ManualOctober 2000Summary of ChangesThe following is a list of the larger changes made to this manual since itslast printing. Other less significant changes were also made throughout.Error Message LogParamacro ParametersSoftkey TreeError MessagesWe use re...

  • Page 4

    Chapter1-2

  • Page 5

    9/Series PAL Reference ManualIndex (General)9/Series GrinderTable of ContentsOperation and Programming ManualiChapter 1Using This Manual1.0 Chapter Overview1-1.................................................................1.1 Audience1-1.............................................................

  • Page 6

    9/Series PAL Reference ManualIndex (General)9/Series GrinderTable of ContentsOperation and Programming Manualii3.3.1 Dresser Orientations3-9...........................................................3.3.2 Grinding Wheel Orientations3-10.....................................................3.4 Ente...

  • Page 7

    9/Series PAL Reference ManualIndex (General)9/Series GrinderTable of ContentsOperation and Programming Manualiii5.4.1 Linear Digitizing5-31..............................................................5.4.2 Digitizing an Arc (3 Points)5-33.......................................................5.4...

  • Page 8

    9/Series PAL Reference ManualIndex (General)9/Series GrinderTable of ContentsOperation and Programming ManualivChapter 8Display and Graphics8.0 Chapter Overview8-1.................................................................8.1 Selection of Axis Position Data Display8-1..........................

  • Page 9

    9/Series PAL Reference ManualIndex (General)9/Series GrinderTable of ContentsOperation and Programming Manualv10.5.2 A_L_,R_,C_ (QuickPath Plus Words)10-21..............................................10.5.3 F Words (Feedrate)10-22...........................................................10.5.4 ...

  • Page 10

    9/Series PAL Reference ManualIndex (General)9/Series GrinderTable of ContentsOperation and Programming ManualviChapter 12Axis Motion12.0 Chapter Overview12-1................................................................12.1 Positioning Axes12-1......................................................

  • Page 11

    9/Series PAL Reference ManualIndex (General)9/Series GrinderTable of ContentsOperation and Programming Manualvii12.9.7 Controlling Spindles (G12.1, G12.2, G12.3)12-71..........................................12.9.8 Spindle Orientation (M19, M19.2, M19.3)12-72.........................................

  • Page 12

    9/Series PAL Reference ManualIndex (General)9/Series GrinderTable of ContentsOperation and Programming Manualviii15.4 Type A Compensation Paths15-17.........................................................15.4.1 Type A Compensation Entry Moves15-17...............................................15...

  • Page 13

    9/Series PAL Reference ManualIndex (General)9/Series GrinderTable of ContentsOperation and Programming ManualixChapter 18Turning Operations18.0 Chapter Overview18-1................................................................18.1 Single Pass Turning Cycles18-1.....................................

  • Page 14

    9/Series PAL Reference ManualIndex (General)9/Series GrinderTable of ContentsOperation and Programming ManualxChapter 21In-process Dresser21.0 Chapter Overview21-1................................................................21.1 Offset Generation While Dressing21-2................................

  • Page 15

    Chapter11-1Using This ManualThis chapter describes how to use this manual. Major topics include:how the manual is written and what fundamentals are presumed to beunderstood by the readerhow the manual is organized and what information can be found in itdefinitions for certain key termsWe wrote th...

  • Page 16

    Chapter 1Using This Manual1-2This table contains a brief summary of each chapter.ChapterTitleSummary1Manual OverviewManual overview, intended audience, definition of key terms, how to proceed.2Operating the ControlA brief description of the control’s basic operation including power-up, MTB pane...

  • Page 17

    Chapter 1Using This Manual1-3To make this manual easier to understand, we included these explanationsof terms and symbols:All explanations, illustrations, and charts presented are based onstandard CNC functions. Operations can differ from the basicinformation provided in this manual depending on ...

  • Page 18

    Chapter 1Using This Manual1-4To make this manual easier to read and understand, we shortened the fullproduct names and features. Shortened terms include:TermDescriptionAMPAdjustable Machine ParametersbackupMemory storage area in the control that does not require battery power to be maintainedCNCC...

  • Page 19

    Chapter 1Using This Manual1-5For more information about Allen-Bradley controls, see these publications:Pub. No.Document Name8520-4.39/Series CNC PAL Reference Manual8520--5.1.19/Series CNC Lathe Operation and Programming Manual8520--5.1.39/Series CNC Mill Operation and Programming Manual8520--5.1...

  • Page 20

    Chapter 1Using This Manual1-6

  • Page 21

    Chapter22-1Operating the ControlThis chapter covers the basics necessary for operation of the Allen-Bradley9/Series control. Major topics covered in this chapter include:Topic:On page:Operator Panel Operations2-2Using the Keyboard2-3Softkeys2-5Using the CRT2-7The Standard MTB Panel2-8Software MTB...

  • Page 22

    Chapter 2Operating the Control2-2Use the operator panel to:display a part programdisplay control status and wheel positionedit a part programdisplay and enter wheel offset datadisplay the status of input/output signalsdisplay and enter programmable zone boundariesset the level of protection for:-...

  • Page 23

    Chapter 2Operating the Control2-3Figure 2.2 shows the color operator panel. It has keys and softkeysidentical to the monochrome operator panel in a slightly differentconfiguration.Figure 2.2ColorOperatorPanel789+456_123=.0:CALCDISP PROCTRANSMITRESCNTRLCANDELLINEEOB)TCH#,L&SPC(D?BS]FEAM[SHIFTG...

  • Page 24

    Chapter 2Operating the Control2-4Table 2.AKey FunctionsKey NameFunctionAddress and Numeric KeysUse these keys to enter alphabetic and numericcharacters. If a key has two characters printed on it,pressing it normally enters the upper left character. Holdingdown the [SHIFT] key while pressing it en...

  • Page 25

    Chapter 2Operating the Control2-5You access the various software features and functions of the controlthrough softkeys. Softkeys are the row of 7 keys located at the bottom ofthe CRT as shown in Figure 2.3. They let you move through the control’ssoftware. The control displays the function of ea...

  • Page 26

    Chapter 2Operating the Control2-6Use the exit softkey {↑} (on the far left) to regress softkey levels. Forexample, if you are currently on softkey level 3 and you press the exitsoftkey, the softkeys change to the softkeys previously displayed onsoftkey level 2. When you press the exit softkey w...

  • Page 27

    Chapter 2Operating the Control2-7Your control has one of these monitors:9-inch monochrome monitor1943512-inch color monitor19436Both have identical displays and graphics capabilities.Certain lines of the screen are dedicated to displaying specific information:LineAreaContent1machine/systemmessage...

  • Page 28

    Chapter 2Operating the Control2-8Figure 2.4 shows the MTB panel. Table 2.B lists the selections on thispanel. Your system may contain optional or custom MTB panels differentthan the one shown below. See the documentation prepared by yoursystem installer for details.We show selection names on the ...

  • Page 29

    Chapter 2Operating the Control2-9Table 2.BSelections on the MTB Panel and How They WorkSwitch or Button NameHow It Works= Default for Push-Button MTB PanelMODE SELECTSelects the operation modeAUTO -- -- automatic modeMANUAL -- -- manual modeMDI -- -- manual data input modeJOG SELECTSelects the jo...

  • Page 30

    Chapter 2Operating the Control2-10Table 2.BSelections on the MTB Panel and How They Work (continued)Switch or Button Name= Default for Push-Button MTB PanelHow It WorksSPINDLE SPEED OVERRIDESelects the override for programmed spindle speeds in 5% increments within a range of 50% to 120%.SPINDLE o...

  • Page 31

    Chapter 2Operating the Control2-11The 9/Series control offers a software MTB panel that performs many ofthe functions of an MTB panel. This feature uses softkeys instead of thenormal switches and buttons of a panel. If your control uses a standardMTB panel (described on page 2-8) or some other cu...

  • Page 32

    Chapter 2Operating the Control2-12The software MTB panel controls these features: (continued)FeatureFunctionJog the AxesAllows manual motions to be performed in any one of the jogging modes. You cannot perform multi-axis jogs usingthe software front panel feature. See page 4-2 for details.Set Zer...

  • Page 33

    Chapter 2Operating the Control2-13JOGAXISPRGRAMEXECSOFTWARE FRONT PANELMODE SELECT:MDIRAPID TRAVERSE:OFFFEEDRATE OVR:0%RAPID FEEDRATE OVR:0%SPINDLE DIRECTION:OFFSPINDLE SPEED OVR:50%DRY RUN MODE:OFFBLOCK DELETE:OFFM-FUNC LOCK:OFFOPTIONAL STOP:OFFSINGLE BLOCK:OFFMIRROR IMAGE:XAXIS INHIBIT:XZUSE CU...

  • Page 34

    Chapter 2Operating the Control2-14Jog Axis ScreenAfter accessing the software front panel screen and selecting the variousfeatures for your application, you can use the jog axis screen to:jog the axes of the controlshift the current work coordinate system to force the current wheelposition to be ...

  • Page 35

    Chapter 2Operating the Control2-15You can select the:axis to jogtype of jogspeed multiply value (see manual operating mode on page 4-1)HPG number (if HPG has been selected as the type of jog)2.Use the up and down cursor keys to select a parameter and the leftand right cursor keys to alter the val...

  • Page 36

    Chapter 2Operating the Control2-16To perform one of these options:1.Press the {PRGRAM EXEC} softkey.(softkey level 2)JOGAXISPRGRAMEXECYou see the program execute screen:BLOCKRETRCEJOGRETRCTCYCLESTARTCYCLESTOPE-STOPPROGRAM[ MM]F0.000 MMPMR X0.000S0.0Z0.000T 0FILENAMESUB NAMEMEMORYMANSTOP

  • Page 37

    BLOCKRETRCEJOGRETRCTCYCLESTARTCYCLESTOP(softkey level 3)BLOCKRETRCEJOGRETRCTCYCLESTARTCYCLESTOP(softkey level 3)JOGAXES+JOGAXES-(softkey level 4)Chapter 2Operating the Control2-172.Press the softkey that corresponds to the selected option.To performthis operation: Press:Cycle Start orCycle Stopth...

  • Page 38

    Chapter 2Operating the Control2-18This section describes the procedures for turning on and off power to thecontrol. See the documentation prepared by your system installer for morespecific procedures.Follow this procedure to turn on power to the control:1.Visually make sure that the control and t...

  • Page 39

    Chapter 2Operating the Control2-19After power has been turned on, the control displays the power turn-onscreen. To activate the main menu, press the [TRANSMIT]key.You see the main menu screen:PROGRAM[ MM]F00000.000 MMPMR X00000.000SZ00000.000T12345FILENAMESUB NAME 9999MEMORYMDISTOP(PAL messages)P...

  • Page 40

    Chapter 2Operating the Control2-20Turn off power to the control when it is not used for an extended period oftime.To turn off power to the control:ATTENTION: To prevent damage to the machine, never turnoff power while a part program is being executed. Beforeturning off power, make sure that the c...

  • Page 41

    Chapter 2Operating the Control2-21The control defaults to one G-code from each of these groups (as set inAMP):Modal Group:G-code:1G00Rapid traverseG01Linear interpolation2G17Plane SelectedG18Plane SelectedG19Plane Selected3G90AbsoluteG91Incremental4G22Programmable Zone 2 and 3 (On)G22.1 Programma...

  • Page 42

    Chapter 2Operating the Control2-22Press the red <EMERGENCY STOP>button on the MTB panel (or any otherE-Stop switches installed on your machine) to stop operations regardless ofthe condition of the control and the machine.ATTENTION: To avoid damage to equipment or hazard topersonnel, your sy...

  • Page 43

    Chapter 2Operating the Control2-23To reset the emergency stop state, press the <E-STOP RESET>button. Onceyou push the E--Stop Reset button to clear the E--Stop state, the message,“RESETTING E--STOP” displays to alert you that the control is attemptingto come out of E--Stop. After the ca...

  • Page 44

    Chapter 2Operating the Control2-24protection by assigning a level as the power-up level using the“POWER-UP LEVEL” parameter as described on page 2-29.This section shows you how to:set the functions assigned to a particular access levelchange the functions assigned to a particular access level...

  • Page 45

    Chapter 2Operating the Control2-25{ACCESS CONTRL}function. Enter a password that has access to{ACCESS CONTRL}.2.Press the {ACCESS CONTRL}softkey. This displays the access controlscreen (Figure 2.5).(softkey level 2)ACCESSCONTRLFigure 2.5Access Control ScreenUPDATE& EXIT01020304PASSWORD NAME -...

  • Page 46

    Chapter 2Operating the Control2-263.Press the softkey that corresponds to the access level for which youwant to assign access to functions. The pressed softkey appears inreverse video. The password name assigned to that access level ismoved to the “PASSWORD NAME.”(softkey level 3)UPDATE& ...

  • Page 47

    Chapter 2Operating the Control2-27Important: If you want to activate or deactivate a function that is notaccessible to the current user’s access level, the message “ACCESS TOTHIS FUNCTION NOT ALLOWED” appears. Only features that areaccessible to the current user’s access level can be sele...

  • Page 48

    Chapter 2Operating the Control2-28Table 2.CPassword Protectable FunctionsParameter NameFunction becomes accessible when parameter name appears in reverse video:1) ACTIVE PROGRAMTo access these features, both ACTIVE PROGRAM and PROGRAM MANAGE (number 2 below) must beassigned to the user.• {SELEC...

  • Page 49

    Chapter 2Operating the Control2-29Table 2.CPassword Protectable Functions (continued)Parameter NameFunction becomes accessible when parameter name appears in reverse video:15) PRGRAMPARAMETERS{PRGRAM PARAM} — Display and change the tables for programmable zones 1 and 2, the single digitfeedrate...

  • Page 50

    Chapter 2Operating the Control2-30If the {ACCESS CONTRL}softkey does not appear on the screen, thecurrently active access level is not allowed to use the{ACCESS CONTRL}function. Enter a password that has access to{ACCESS CONTRL}.2.Press the {ACCESS CONTRL}softkey. This displays the access control...

  • Page 51

    Chapter 2Operating the Control2-31To enter a password, follow these steps:1.Press the {PASSWORD}softkey.(softkey level 1)FRONTPANELERRORMESAGEPASS-WORDSWITCHLANGYou see the password log-on screen:ACCESSCONTRLENTER PASSWORD:PROGRAM[INCH]F0.000 MMPMZ00000.000S0R X00000.000T1C359.99MEMORYMANSTOPE-ST...

  • Page 52

    Chapter 2Operating the Control2-32The control provides 3 basic operation modes:Manual (MAN or MANUAL)Manual Data Input (MDI)Automatic (AUTO)You can select a mode by using <MODE SELECT>on the MTB panel, or byusing the {FRONT PANEL}softkey. This is configurable by your systeminstaller. Both m...

  • Page 53

    Chapter 2Operating the Control2-33(1) Manual modeTo operate the machine manually,select MAN or MANUAL under <MODE SELECT>orpress the {FRONT PANEL}softkey.Use the left/right arrow keys to change the mode select options if using{FRONT PANEL}. Details about using the {FRONT PANEL}softkey are g...

  • Page 54

    Chapter 2Operating the Control2-34(2) MDI modeTo operate the machine in MDI mode,select MDI under <MODE SELECT>orpress the {FRONT PANEL}softkeyUse left/right arrow keys to change mode select options if using{FRONT PANEL}. Details about using the {FRONT PANEL}softkey are givenon page 2-11.Fo...

  • Page 55

    Chapter 2Operating the Control2-35(3) Automatic modeTo operate the machine automatically,select AUTO under <MODE SELECT>orpress the {FRONT PANEL}softkeyUse left/right arrow keys to select mode options if using {FRONT PANEL}.Details about using the {FRONT PANEL}softkey are given on page 2-11...

  • Page 56

    Chapter 2Operating the Control2-36Block ResetUse the block reset feature to force the control to skip the execution of ablock. To use the block reset function, you must stop program execution.If program execution is stopped:Then:before the control has completely finished theexecution of the block...

  • Page 57

    Chapter 2Operating the Control2-37The control has two screens dedicated to displaying messages. TheMESSAGE ACTIVE screen displays up to nine of the most currentsystem messages and ten of the most current machine (logic generated)messages at a time. The MESSAGE LOG screen displays a log of up to99...

  • Page 58

    Chapter 2Operating the Control2-38Figure 2.9Message Active Display ScreenERRORLOGCLEARACTIVEMESSAGE ACTIVESYSTEM MESSAGE(The system error messages are displayed in this area)MACHINE MESSAGE(The logic messages are displayed in this area)This is the information displayed on the MESSAGE ACTIVE scree...

  • Page 59

    Chapter 2Operating the Control2-39Figure 2.10Message Log Display ScreenACTIVEERRORSTIMESTAMPSMESSAGE LOGPAGE 1 of 9SYSTEM MESSAGE(The logged system error messages are displayed inthis area)MACHINE MESSAGE(The logged logic messages are displayed in this area)This is the information displayed on th...

  • Page 60

    Chapter 2Operating the Control2-40After the cause of a machine or system message has been resolved, somemessages remain displayed on all screens until cleared.ATTENTION: Not clearing the old messages from the screencan prevent messages that are generated later from beingdisplayed. This occurs whe...

  • Page 61

    Chapter 2Operating the Control2-41The input cursor is the cursor located on line 2 and 3 of the screen. Itappears when you must input data using the operator panel (as needed inMDI mode, for example). This section describes how to move the cursorand edit data on the input line by using the keys o...

  • Page 62

    Chapter 2Operating the Control2-42Sometimes you must perform a reform memory operation on the control toclear memory. Typically, you do this when:the amount of RAM memory that can be used by PAL is changed inAMPa new PAL program has been sent to the control (downloading PALdoes not always make it...

  • Page 63

    Chapter 2Operating the Control2-432.Press the {REFORM MEMORY}softkey.REFORMMEMORYCHANGEDIRACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMDELETEPRGRAMVERIFYPRGRAMPRGRAMCOMENTRENAMEPRGRAMINPUTDEVICE(softkey level 2)3.Press the {REFORM YES}softkey. All programs that are stored incontrol mem...

  • Page 64

    Chapter 2Operating the Control2-44The time parts count display logs data relevant to part program execution,including:number of parts groundcycle timelot sizeremaining partsYou display and alter this data through the time parts screen.Three levels of access are available to the time parts screen....

  • Page 65

    Chapter 2Operating the Control2-452.Press the {ACTIVE PRGRAM}softkey.REFORMMEMORYCHANGEDIRACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMDELETEPRGRAMVERIFYPRGRAMPRGRAMCOMENTRENAMEPRGRAMINPUTDEVICE(softkey level 2)3.Press the {TIME PARTS}softkey.(softkey level 3)DE-ACTPRGRAMSEARCH MID STP...

  • Page 66

    Chapter 2Operating the Control2-46Important: All softkeys appear in Figure 2.11 may not appear on yoursystem due to restricted access. See the beginning of this section and page2-27 for details.Table 2.D lists the time part screen fields and their definitions.Table 2.DTime Part Screen Field Defin...

  • Page 67

    Chapter 2Operating the Control2-47Changing DateTo change the date setting:1.Press the {SET DATE}softkey, provided that you havesupervisor-level access.You are prompted for a new date with a line that displays the currentdate setting.2.Press the [DEL]key to erase the characters displayed.3.Type in...

  • Page 68

    Chapter 2Operating the Control2-48Clearing/Resetting a FieldTo clear/reset a field to zero:1.Press the {ED PRT INFO}softkey, provided that you havesupervisor-level access.2.Press the up and down cursor keys to move to the field you want toclear/reset.3.Enter a Y or a numeric value at the prompt f...

  • Page 69

    Chapter 2Operating the Control2-49For the calculator function, 2147483647 (10 characters long) is the largestnumber that you can enter on the input line.If you see the error message:The number entered or calculated is:“NUMBER IS OUT OF RANGE”too large (longer than 10 characters)“MATH OVERFL...

  • Page 70

    Chapter 2Operating the Control2-50If you perform the same level of evaluation, the left most operation takespriority.Example 2.1Mathematic ExpressionsExpression EnteredResult Displayed12/4*3912/[4*3]112+2/213[12+2]/2712-4+31112-[4+3]5Table 2.F contains the function commands available with the [CA...

  • Page 71

    Chapter 2Operating the Control2-51The control executes functions in Table 2.F from left to right in a programblock. These functions are executed before the control executes anymathematical operators such as addition or subtraction. This order ofexecution can be changed only by enclosing operation...

  • Page 72

    Chapter 2Operating the Control2-52Paramacro Variables in CALC OperationsAny paramacro variable can be accessed through the CALC function.Include a # sign followed by the paramacro variable number. When thecalculation is performed the value of that paramacro variable is substitutedinto the equatio...

  • Page 73

    Chapter33-1Offset Tables and SetupThis chapter describes the offset tables and their setup. The major topicsdescribed in this chapter include:Topic:On page:Wheel Length Offset Tables {WHEEL GEOMET}3-1Dresser/Wheel Radius Offset {RADIUS TABLE}3-4Dresser/Wheel Orientation {RADIUS TABLE}3-8Dresser O...

  • Page 74

    Chapter 3Offset Tables and Setup3-2Figure 3.1Wheel length OffsetsWheel gauge point on spindle from whichwheel offsets are usually measured(determined by your systeminstaller)Wheel length offsets simplifyprogramming and allow processing fromdifferent points on the wheel withoutchanging the part pr...

  • Page 75

    Chapter 3Offset Tables and Setup3-3Important: The first 4 wheel offset numbers (01-04) are reserved for usein conjunction with an in-process dresser. When the in-process dresser isdisabled, the control automatically updates these first 4 offset numberswith the current grinding wheel size. These o...

  • Page 76

    Chapter 3Offset Tables and Setup3-4Figure 3.2 shows typical length offsets for a cylindrical grinder. Generallygrinders are configured such that axes move in the negative direction asthey move the wheel towards the workpiece (along -X axis) and towardsthe chuck (along -Z axis). Assuming this appl...

  • Page 77

    Chapter 3Offset Tables and Setup3-5The dresser radius and corner radius compensation schemes use the sameradius table to store a radius value. The entire wheel radius scheme storesthe entire wheel radius in paramacro variable #5508. Which dresser/wheelradius compensation scheme to use on your sys...

  • Page 78

    Chapter 3Offset Tables and Setup3-6Dresser RadiusThe control can compensate for errors resulting from slight or even largerounding of the dresser tip. To do so, the radius of the dresser must beentered in the radius table. For more information on activating an offsetfor dresser/wheel radius compe...

  • Page 79

    Chapter 3Offset Tables and Setup3-7Figure 3.5Corner Radius for a Typical Grinding WheelX length offsetZlengthoffsetX length offsetZlengthoffset.25Radius.3Radius11986-IEntire Wheel RadiusThe control can compensate for the radius of the entire grinding wheel. Todo so, the radius of the wheel must b...

  • Page 80

    Chapter 3Offset Tables and Setup3-8Figure 3.6Entire Wheel Radius for a Typical Grinding Wheel11987-IRadius ofEntire WheelOrientation of the grinding wheel or diamond point dresser is essentialinformation for dresser/wheel radius compensation to function properly.Orientation data tells the control...

  • Page 81

    Chapter 3Offset Tables and Setup3-9Figure 3.7 shows the possible dresser orientations relative to the grindingwheel.Figure 3.7Dresser Orientations162438750or 911988-IThe control uses the value selected for orientation to determine theorientation of the dresser when dresser/wheel radius compensati...

  • Page 82

    Chapter 3Offset Tables and Setup3-10Figure 3.8 shows the possible grinding wheel orientations relative to thepart surface. The orientation numbers point to the surface of the grindingwheel beingusedtogrind the part.Figure 3.8Wheel Orientations384216570or 95711989-IThe control uses the value selec...

  • Page 83

    Chapter 3Offset Tables and Setup3-11Enter data in the offset tables by using one of six methods:Method:On Page:Editing wheel offset tables {WHEEL GEOMET} or{RADIUS TABLE}3-11Using {MEASURE}3-16Programming G1013-5Skip functions19-3Setting paramacro system parameters20-16Editing through the PAL pro...

  • Page 84

    Chapter 3Offset Tables and Setup3-122.Decide if you want to display:wheel length offset tableorradius/orientation offset table(softkey level 2)WORKCO-ORDWHEELGEOMETRADIUSTABLEDRESSRTABLESCALNGCOORDROTATEBACKUPOFFSETTo display:Press this softkey:wheel length offsets{WHEEL GEOMET}An example of a wh...

  • Page 85

    Chapter 3Offset Tables and Setup3-134.Select data entry type:Unit selection {INCH/METRIC}To select units of “mm” or “inch” for the offset data, press the{INCH/METRIC} softkey. The unit selection changes each time youpress the softkey. When you alter the units, the control converts allexis...

  • Page 86

    Chapter 3Offset Tables and Setup3-145.Offset data can be replaced or added to:If you want to:Key in the:Press this softkey:replace stored offset data with new datanew data{REPLCE VALUE}add to previously stored offset dataamount to be added{ADD TO VALUE}You can copy length offset data from one axi...

  • Page 87

    Chapter 3Offset Tables and Setup3-15Figure 3.9Offset Table Screen for Wheel LengthSEARCHNUMBERREPLCEVALUEADD TOVALUEACTIVEOFFSETMOREOFFSETTOOL OFFSET NUMBER:WHEEL GEOMETRY TABLEPAGE1 OF 7TOOL #1[INCH]2[INCH]3[INCH]R X-12345.678-12345.678-12345.678Z-12345.678-12345.678-12345.678TOOL #4[INCH]5[INCH...

  • Page 88

    Chapter 3Offset Tables and Setup3-16The measure feature offers an easy method of establishing wheel lengthoffsets. This feature is not available for generating any radius offset data.The control, not the operator, computes the wheel length offsets, and entersthese values in the wheel geometry off...

  • Page 89

    Chapter 3Offset Tables and Setup3-17This feature allows the manual activation of wheel length andradius/orientation offsets without the need to program the correct T wordto call the corresponding offset number.Typically you change the wheel length and radius/orientation offsets byprogramming a T ...

  • Page 90

    Chapter 3Offset Tables and Setup3-184.Press the {ACTIVE OFFSET} softkey when the offset you want isselected. Length offsets are made active as described in chapter 13.Radius/orientation offsets are made active as described in chapter 15.(softkey level 3)SEARCHNUMBERREPLCEVALUEADD TOVALUEACTIVEOFF...

  • Page 91

    Chapter 3Offset Tables and Setup3-19Enter data in the coordinate system table by using one of four methods:Method:On page:Entering work coordinate data manually3-19Programming G1011-8 and 11-11Setting paramacro system variables20-16Entering through the PAL programsee the PAL Reference manual or d...

  • Page 92

    Chapter 3Offset Tables and Setup3-20Figure 3.11Work Coordinate System Data EntryREPLCEVALUEADD TOVALUEINCH/METRICRADI/DIAMMOREOFFSETWORK COORDINATES TABLEPAGE1OF4DIAMOND 1DIAMOND 2CHUCK 1G54[INCH]G55[ MM ]G56[ MM ]R X-999.9999X-999.9999X-999.9999Z-999.9999Z-999.9999Z-999.99993.Move the cursor to ...

  • Page 93

    Chapter 3Offset Tables and Setup3-214.Select data entry type:Unit selection {INCH/METRIC}To select units of “mm” or “inch” for the offset data, press the{INCH/METRIC} softkey. The unit selection changes each time youpress the softkey. When you alter the units, the control converts allexis...

  • Page 94

    Chapter 3Offset Tables and Setup3-22Important: You can alter the values for the work coordinate systems byusing the G10 command in MDI or within a part program. For details onG10 commands, see page 11-8 and 11-11.Entering a Coordinate System LabelThe work coordinate system table provides an area ...

  • Page 95

    Chapter 3Offset Tables and Setup3-23The control can back up all the information entered in the offset tables andthe work coordinate system tables. The control can generate a programconsisting of G10 blocks to save these tables. These G10 blocks cancontain offset and work coordinate values. Any ti...

  • Page 96

    Chapter 3Offset Tables and Setup3-24The backup offset screen appears:TOPORT ATOPORT BTOFILEBACKUP TOOL OFFSETSRADIUS TABLEWHEEL GEOMETRY TABLEWORK COORDINATE OFFSETSALLSELECT OPTION USING THE UP/DOWN ARROW3.Select the offsets you want to back up by using the up and downcursor keys. The selected o...

  • Page 97

    Chapter 3Offset Tables and Setup3-255.When you press the {TO FILE} softkey, the control prompts you fora program name. Enter a program name by using the alphanumerickeys on the operator panel and press the [TRANSMIT] key (see page10-8 on program names).If you press {TO PORT A} or {TO PORT B} inst...

  • Page 98

    Chapter 3Offset Tables and Setup3-263.Press the {ZONE LIMITS} softkey to display the programmablezone table.(softkey level 3)ZONELIMITSF1-F9The programmable zone table appears:REPLCEVALUEADD TOVALUEUPDATE& EXITQUITENTER VALUE:PROGRAMMABLE ZONELOWER LIMITUPPER LIMITLIMIT 2R XAXIS-10.00000.0000...

  • Page 99

    Chapter 3Offset Tables and Setup3-275.Data can be replaced or added to:(softkey level 4)REPLCEVALUEADD TOVALUEMORELIMITSUPDATE& EXITQUITIf you want to:Key in the:Press this softkey:replace stored zone data with new datanew data{REPLCE VALUE}add to previously stored zone dataamount to be added...

  • Page 100

    Chapter 3Offset Tables and Setup3-282.Press the {PRGRAM PARAM} softkey.(softkey level 2)PRGRAMPARAMAMPDEVICESETUPMONI-TORTIMEPARTSPTOMSI/OEMSYSTEMTIMING3.Press the {F1 - F9} softkey to display the single-digit feedrate table.(softkey level 3)ZONELIMITSF1-F9The single-digit feedrate table appears:...

  • Page 101

    Chapter 3Offset Tables and Setup3-294.Use the up and down cursor keys to move the cursor to the feedrateyou want to change. The selected feedrate appears in reverse video.5.Change feedrate values by using one of two choices:(softkey level 4)REPLCEVALUEADD TOVALUEUPDATE& EXITQUITIf you want to...

  • Page 102

    Chapter 3Offset Tables and Setup3-30(softkey level 2)PRGRAMPARAMAMPDEVICESETUPMONI-TORTIMEPARTSPTOMSI/OEMSYSTEMTIMING3.Press the {AXIS PARAM} softkey.(softkey level 3)AXISPARAMPATCHAMPUPDATEBACKUPUPLD/DWNLDBACKUPAMP4.Press the {RANGE PARAM} softkey.(softkey level 4)SPNDLPARAMSERVOPARAMAXISCALIBHO...

  • Page 103

    Chapter 3Offset Tables and Setup3-31About the Offset Range Verification Screenon a grinder, range checking units for this screen are always RADIUS,regardless of the program/control modedisplay format is fixedModePlaces to the left of the decimal pointPlaces to the right of the decimal pointinch35...

  • Page 104

    Chapter 3Offset Tables and Setup3-32

  • Page 105

    Chapter44-1Manual/MDI Operation ModesThis chapter describes the manual and MDI operating modes. Major topicscovered include:Topic:On page:Manual Operating Mode4-1Jogging an Axis4-2Continuous Jog4-3Incremental Jog4-3HPG Jog4-4Arbitrary Angle Jog4-5Manual Gap Elimination4-6Resetting Overtravels4-9M...

  • Page 106

    Manual/MDI Operation ModesChapter 44-2Figure 4.1Data Display in MANUAL ModePRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTE-STOPPROGRAM[ MM]F00000.000 MMPMX00000.000S0.0Z00000.000T1U00000.000W00000.000MEMORYMDISTOPN 99999(First 4 blocksof program shown here)(PAL messages)In the jog mode, pus...

  • Page 107

    Manual/MDI Operation ModesChapter 44-3During a jog retract operation (see chapter 7), you are permitted to useonly normal single axis jogs (one axis at a time in the continuous,incremental, or HPG modes).To jog an axis continuously:1.Select CONTINUOUS under <JOG SELECT>.2.Select the feedrat...

  • Page 108

    Manual/MDI Operation ModesChapter 44-4axis. This includes attempts to perform other incremental moves onthat axis.The control normally jogs the axes, the selected distance and direction, atthe feedrate set in AMP for the MED feedrate. Your system installer canselect a different feedrate with a sp...

  • Page 109

    Manual/MDI Operation ModesChapter 44-54.Typical HPG configuration results in:If you select:The direction for the axis is:clockwiseplus (+)counterclockwiseminus (-)-+11999-IYour system installer can enable a feature that allows control of the angleof a multiple axis jog. Since this feature is PAL ...

  • Page 110

    Manual/MDI Operation ModesChapter 44-6The manual gap elimination feature allows the operator to manually jog thegrinding wheel without interrupting reciprocation. Using this feature, theoperator can speed up the grinding process by skipping over reciprocationstrokes that are not making wheel cont...

  • Page 111

    Manual/MDI Operation ModesChapter 44-7If you attempt to perform a manual gap elimination while dresser/wheelradius compensation is active, a change in resulting contour can occur asdresser/wheel radius compensation must be re-initialized at the end ofthe manual gap elimination jog. Make sure no d...

  • Page 112

    Manual/MDI Operation ModesChapter 44-8Results of Gap EliminationWhen you perform manual gap elimination during block execution (as canbe the case in AUTO or MDI modes), it bypasses any motion generated byan executing cycle block that occurs above the newly jogged to position.Cycle execution conti...

  • Page 113

    Manual/MDI Operation ModesChapter 44-9The control stops wheel motion during overtravel conditions. Overtravelconditions can occur from 3 causes:Overtravel ConditionCausehardware overtravelThe axes reach a travel limit, usually set by a limit switch orsensor mounted on the axis.Hardware overtravel...

  • Page 114

    Manual/MDI Operation ModesChapter 44-103.Press the <E-STOP RESET>button to reset the emergency stopcondition. If the E-Stop does not reset, it is a result of some causeother then overtravel causing E-Stop.4.Make sure it is safe to move the axis away from the overtravel limit.5.Use any of th...

  • Page 115

    Manual/MDI Operation ModesChapter 44-11The machine home return operation means the positioning of a specifiedlinear or rotary axis to a machine-dependent fixed position, which is calledthe machine home. This position is established via a home limit switchmounted on the machine and the marker on y...

  • Page 116

    Manual/MDI Operation ModesChapter 44-12Figure 4.5Manual Machine HomeTo execute the manual return to machine home position:1.Select HOME under <JOG SELECT>.2.Place the control in manual mode (see page 4-1).3.Determine the direction that each axis must travel to reach the homelimit switch. Se...

  • Page 117

    Manual/MDI Operation ModesChapter 44-13In manual data input (MDI) mode, you can control machine operations byentering program blocks directly using the keys on the operator panel.To begin MDI operations, select MDI under <MODE SELECT>or press the{FRONT PANEL}softkey followed by the left and...

  • Page 118

    Manual/MDI Operation ModesChapter 44-14Figure 4.6Program Display Screen in MDI ModePRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTE-STOPPROGRAM[ MM]F00000.000 MMPMX00000.000S0Z00000.000T1U00000.000W00000.000MEMORYMDISTOPN 99999(First 4 blocksof MDI shown here)(PAL messages)You can call subpr...

  • Page 119

    Manual/MDI Operation ModesChapter 44-15The input cursor is the cursor shown on the input lines (lines 2 and 3on the screen). To move the cursor left and right in the input area,press and hold the [SHIFT] key while pressing the left and rightcursor keys. The control inserts a new character to the ...

  • Page 120

    Manual/MDI Operation ModesChapter 44-16Figure 4.7MDI Mode Program ScreenPRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTE-STOPPROGRAM[ MM]F00000.000 MMPMZ00000.000S0R X00000.000T1U359.99MEMORYMDISTOPN 99999(First 4 blocksof MDI shown here)(PAL messages)Important: Performing a block reset oper...

  • Page 121

    Chapter55-1Editing Programs On LineThis chapter covers the basics of editing programs on line (at the control’skeyboard) including:Topic:On page:Selecting a Program to Edit5-1Editing Programs at the Control (on line)5-3Programming Aids {QuickView}5-16Digitizing a Program (Teach)5-28Deleting a P...

  • Page 122

    Editing Programs On LineChapter 55-2To begin an edit operation on an active or inactive part program:1.Press the {PRGRAM MANAGE}softkey.(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTFRONTPANELERRORMESAGEPASS-WORDSWITCHLANGThe control displays the main part program directory...

  • Page 123

    Editing Programs On LineChapter 55-33.Select the part program you want to edit by using one of these twomethods:Key in the program name of the part program to edit or createorMove the cursor to the program name on the program directoryscreen by using the up and down cursor keysImportant: If you a...

  • Page 124

    Editing Programs On LineChapter 55-4ATTENTION: Any edit operation on a part program ispermanent. You cannot discard any changes that you made to aprogram. The control saves programs in memory at the sametime they are edited.Two major areas of the edit screen are dedicated to displaying specificin...

  • Page 125

    Editing Programs On LineChapter 55-5This section covers moving the cursor in the program display area (lines7-20 of the CRT). It assumes that you have selected a program to edit ascoveredonpage 5-1.The input cursor is the cursor shown on the input lines (lines 2 and 3 on thescreen). Details on th...

  • Page 126

    Editing Programs On LineChapter 55-64.Select in which direction to search the part program.(softkey level 4)FORWRD REVRSETOP OFPRGRAMBOT OFPRGRAMTo search the part program in the:Press this softkey:forward direction{FORWRD}reverse direction{REVRSE}If the control cannot find the character or chara...

  • Page 127

    Editing Programs On LineChapter 55-7After you have selected a part program to edit, use the following method toadd lines, blocks, or characters to the part program. The control should bein the edit mode at this point with EDIT: displayed in the input area of thescreen (lines 2-3).To enter blocks ...

  • Page 128

    Editing Programs On LineChapter 55-82.Use the up, down, left, and right cursor keys to move the block cursorto the location where you need to change characters. The charactersto changed appear in reverse video.3.Key in a new character or word to replace data located within thecursor, then press t...

  • Page 129

    Editing Programs On LineChapter 55-9InsertingYou can insert characters, words, and blocks to the left of the programdisplay cursor within an already existing or newly created part program.Follow these steps to use the insert function.1.From the edit menu, press the {MODIFY INSERT}softkey until th...

  • Page 130

    Editing Programs On LineChapter 55-10Example 5.5Inserting CharactersTo change “X123.0” to “X123.034”Program Block(Program Display Area)Enter(Input Area)NotesN1000X123.0Z45.0;Move the cursor to “Z” and toggle the {MODIFY/INSERT}softkey to “INSERT:”.N1000X123.0Z45.0;34Type this data...

  • Page 131

    Editing Programs On LineChapter 55-113.Press the {DELETE CH/WRD} softkey.DIGITZEMODIFYINSERTBLOCKDELETEBLOCKTRUNCDELETECH/WRDEXITEDITORSTRINGSEARCHRENUMPRGRAMMERGEPRGRAMQUICKVIEWCHAR/WORD(softkey level 3)Erasing Commands to the EOB1.From the edit menu, move the cursor until the first character or...

  • Page 132

    Editing Programs On LineChapter 55-12Erasing An Entire Block1.From the edit menu, move the cursor until it is located on anycharacter that is in the block you want to delete.2.Press the {BLOCK DELETE}softkey. The control erases the selectedblock including the end of block character.DIGITZEMODIFYI...

  • Page 133

    Editing Programs On LineChapter 55-13You can assign each block in a part program a five-digit numeric valuefollowing an N address. These numbers are referred to as sequencenumbers and distinguish one block from another.You can assign sequence numbers at random to specific blocks or to allblocks. ...

  • Page 134

    Editing Programs On LineChapter 55-143.Key in an initial sequence number (the number for the first sequencenumber), a comma, and an incremental value for the control to add toeach new sequence number. The format to this command isRENUM: initial-sequence-number, incremental-valueFor exampleRENUM:5...

  • Page 135

    Editing Programs On LineChapter 55-15You can merge a complete part program within another part program whileone of the programs is in the edit mode. To merge part programs, followthese steps:1.Use the up, down, left and right cursor keys to move the block cursorto the location in the program disp...

  • Page 136

    Editing Programs On LineChapter 55-16To exit the edit mode from the edit menu, press the {EXIT EDITOR}softkey.DIGITZEMODIFYINSERTBLOCKDELETEBLOCKTRUNCDELETECH/WRDEXITEDITORSTRINGSEARCHRENUMPRGRAMMERGEPRGRAMQUICKVIEWCHAR/WORD(softkey level 3)Important: Do not press the Exit {↑ } softkey to leave...

  • Page 137

    Editing Programs On LineChapter 55-17The QuickView feature aids the programmer by giving access to:QuickPath Plus Prompts -- a selection of commonly used samplepatterns representing a series of machining steps with prompts for thenecessary words to program it using QuickPath Plus. See page 12-11f...

  • Page 138

    Editing Programs On LineChapter 55-18See the following subsections for information about using the QuickViewfunctions.Axis SelectionThe selection of the axes that can be programmed using QuickView isdetermined by the type of QuickView prompt you are using. G codes areeither planar, or non-planar....

  • Page 139

    Editing Programs On LineChapter 55-19With the QuickView functions and QuickPath Plus, you can usedimensions from part drawings directly to create a part program. Thesample patterns available with the QuickPath Plus prompts are summarizedbelow.Usethispattern:When you are programmingthis geometry:A...

  • Page 140

    Editing Programs On LineChapter 55-20Angle of a line, corner radius, and chamfer size are often necessary for asample pattern in QuickPath Plus prompting. These prompts in QuickPathPlus prompting refer to these drawing dimensions:If you see a:It means:AAngle,RCorner radius,CChamfer sizeLLength of...

  • Page 141

    Editing Programs On LineChapter 55-21The control displays the first QuickPath Plus sample pattern screen:CIRCLE, ANGLE, POINTANGLE, CIRCLE, POINTANGLE, POINTCIRCLE , CIRCLECIRANG PTCIRCIRANGCIR PTANGPTQUICKPATH PLUS MENU 12.Select a sample pattern matching the part geometry you want toprogram and...

  • Page 142

    Editing Programs On LineChapter 55-224.After you enter all data for the pattern, press the {STORE}softkey tostore the data.STORE(softkey level 6)The control generates the necessary block(s) to create the axismoves. The control displays these blocks in the input area next tothe EDIT: prompt. You c...

  • Page 143

    Editing Programs On LineChapter 55-23G-code format prompting aids the operator in programming different Gcodes by prompting the programmer for the necessary parameters. Agraphical representation is usually provided to show the programmer asample of what the G-code parameters are used for.Grinder ...

  • Page 144

    Editing Programs On LineChapter 55-244.Use the up and down cursor keys to select the parameters you want tochange or enter. The selected item appears in reverse video.Axis words followed by a (1), (2), or (3) are prompting for the first,second, or third coordinate position respectively. The locat...

  • Page 145

    Editing Programs On LineChapter 55-25Grinder cycle prompting aids the operator in programming surface orcylindrical grinding cycle blocks by prompting the programmer for thenecessary parameters and giving a graphical representation of the cycleoperation.For G-code prompts other than these cycles,...

  • Page 146

    Editing Programs On LineChapter 55-26If you have configured a surface grinder, this screen appears:SELECTE-STOPGRINDER PROMPT MENUDISPLAY.G80CANCEL OR END FIXED CYCLEG81RECIPROCATIONG81.1RECIPROCATION PREDRESSG82PLUNGEG82.1PLUNGE PREDRESSG83INCREMENTAL PLANE 1G83.1INCREMENTAL PLANE 1 PREDRESSG84I...

  • Page 147

    Editing Programs On LineChapter 55-276.After you enter all data for the G code, press the {STORE}softkey tostore the data.STORE(softkey level 6)The control generates the necessary G code block. The controldisplays the generated block in the input area next to the EDIT:prompt. You can edit this bl...

  • Page 148

    Editing Programs On LineChapter 55-282.Press the softkey that corresponds to the plane you want to programin (G17, G18, or G19). See documentation prepared by your systeminstaller for details on the planes selected by these G-codes.The display changes to show the selected plane.SETANGLEDG17G18G19...

  • Page 149

    Editing Programs On LineChapter 55-29To use the digitize feature:Important: The following description covers the use of softkeys toperform digitizing. Your system installer may have written PAL to allowsome other method of digitizing. If this is the case, see documentationprovided by your system ...

  • Page 150

    Editing Programs On LineChapter 55-305.Press the softkey that corresponds to the mode you want to change.(softkey level 5)INCH/METRICABS/INCRPLANESELECTDIA/RADIUSThe control displays the mode that the next block is programmed inin the upper right hand corner of the screen. The modes and theirabbr...

  • Page 151

    Editing Programs On LineChapter 55-317.Determine if the next move is linear or circular.LINEAR CIRCLE3 PNTCIRCLETANGNTMODESELECT(softkey level 4)If the next move is:Then press this softkey:linear{LINEAR} (see page 5-31)circular{CIRCLE 3 PNT} if 3 points on the arc are known (see page5-33)or{CIRCL...

  • Page 152

    Editing Programs On LineChapter 55-322.Reposition the wheel at the desired end point of the linear move byusing any of the following methods:Jog the Axes in MANUAL modeAutomatically move the axes by executing a part program or MDIprogramManually move the axes using any means as long as the encode...

  • Page 153

    Editing Programs On LineChapter 55-33To digitize a 3 point arc:1.Press the {CIRCLE 3 PNT}softkey.When you press the {CIRCLE 3 PNT}softkey, the control sets thecurrent wheel position as the start point (first point of 3 that isnecessary to describe an arc) of a circular move.The screen changes to ...

  • Page 154

    Editing Programs On LineChapter 55-344.Press either the {STORE END PT}or the {EDIT & STORE}softkeys tostore this block as a circular block. This records the current wheellocation as the final position for this digitize operation.The {STORE END PT}softkey does not return the control to theprog...

  • Page 155

    Editing Programs On LineChapter 55-35To digitize an arc that is tangent at the endpoint of the previous path:1.Press the {CIRCLE TANGNT}softkey.When you press the {CIRCLE TANGNT}softkey, the control sets thecurrent wheel position as the start point of a circular move. If theprevious block was cir...

  • Page 156

    Editing Programs On LineChapter 55-363.Press either the {STORE END PT}or the {EDIT & STORE}softkeysafter the axes have been positioned at the end point of the arc. Thecontrol stores the current wheel position as the end point of the arc.The {STORE END PT}softkey does not return the control to...

  • Page 157

    Editing Programs On LineChapter 55-37To delete a part program stored in memory:1.Press the {PRGRAM MANAGE}softkey.(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTFRONTPANELERRORMESAGEPASS-WORDSWITCHLANG2.Press the {DELETE PRGRAM}softkey.REFORMMEMORYCHANGEDIRACTIVEPRGRAMEDITPR...

  • Page 158

    Editing Programs On LineChapter 55-38To change the program names assigned to the part programs stored inmemory:1.Press the {PRGRAM MANAGE}softkey.(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTFRONTPANELERRORMESAGEPASS-WORDSWITCHLANG2.Press the {RENAME PRGRAM}softkey.REFORMM...

  • Page 159

    Editing Programs On LineChapter 55-39The 9/Series control has a part program display feature that lets you view,but not edit, any part program.Follow these steps to display a part program stored in the control’smemory:1.Press the {PRGRAM MANAGE}softkey.(softkey level 1)PRGRAMMANAGEOFFSET MACROP...

  • Page 160

    Editing Programs On LineChapter 55-40You can assign each individual program a short comment that is displayedon the program directory screens. Use these comments to help identify aprogram when selecting it for automatic operation or for editing.Important: These comments are not normally the same ...

  • Page 161

    Editing Programs On LineChapter 55-41If a comment has previously been entered, it is displayed to the rightof the “COMMENT” prompt. This comment can be edited using theinput cursor as covered on page 2-41, or the old comment can bedeleted by pressing the [DEL]key while holding down the [SHIFT...

  • Page 162

    Editing Programs On LineChapter 55-424.Key in a comma followed by a new program name for the duplicateprogram.COPY: FROM_NAME,TO_NAME5.Press the {MEM TO MEM}softkey.MEM TOPORT APORT ATO MEMMEM TOPORT BPORT BTO MEMMEM TOMEM(softkey level 3)The following message appears:“FROM: (source program nam...

  • Page 163

    Editing Programs On LineChapter 55-43If you have access to the {CHANGE DIR}softkey, you can:perform any of the program edit functions on the protected programsdirectly select and activate any of the protected programsview programs executing from this directoryYou can only call a protected program...

  • Page 164

    Editing Programs On LineChapter 55-442.Press the {CHANGE DIR}softkey.REFORMMEMORYCHANGEDIRACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMVERIFYPRGRAMPRGRAMCOMENTDELETEPRGRAMRENAMEPRGRAMINPUTDEVICE(softkey level 2)Important: The control does not display the {CHANGE DIR}softkeyif your pass...

  • Page 165

    Editing Programs On LineChapter 55-45The programs in this directory are protected. This means:they are processed the same as unprotected programsthe blocks of protected programs are not displayed during programexecution unless you have access to the {CHANGE DIR}softkey (in placeof the protected p...

  • Page 166

    Editing Programs On LineChapter 55-46To set up the character encryption/decryption table:1.Select the protected part program directory.2.Press the {SET-UP NCRYPT}softkey.REFORMMEMORYCHANGEDIRNCRYPTMODESET-UPNCRYPTACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMVERIFYPRGRAMPRGRAMCOMENTDELE...

  • Page 167

    Editing Programs On LineChapter 55-47To fill in the encryption/decryption table by using the operator panelkeys:use the arrow keys to move the cursor to the place where you wantto assign an encryption/decryption characterthen enter a character and press the [TRANSMIT]keyYou must enter a unique ch...

  • Page 168

    Editing Programs On LineChapter 55-484.Press the {UPDATE & EXIT}softkey to update and exit theencryption/decryption table.UPDATE& EXITSTOREBACKUPREVRSEFILL(softkey level 3)When you press the {UPDATE & EXIT}softkey, the control does acompile/check of the encryption/decryption table to ...

  • Page 169

    Editing Programs On LineChapter 55-493.Press the {STORE BACKUP}softkey. The control displays the message“STORING TO BACKUP -- PLEASE WAIT” on the CRT until thecontrol has finished storing the encryption/decryption table to itsbackup memory.UPDATE& EXITSTOREBACKUPREVRSEFILL(softkey level 3...

  • Page 170

    Editing Programs On LineChapter 55-50

  • Page 171

    Chapter66-1Editing Part Programs Off Line (ODS)This chapter describes the Offline Development System (ODS). The majortopics in this chapter include:Topic:On page:Selecting the Part Program Application6-2Editing Part Programs Off Line6-3Connecting the Workstation to the Control6-5Downloading Part ...

  • Page 172

    Editing Part Programs Off LineChapter 66-2Selecting the Part Program application provides access to the part programutilities of ODS. To select the Part Program application:1.Return to the main menu line of ODS.2.Press [F3]to pull down the Application menu:The workstation displays this screen:F1 ...

  • Page 173

    Editing Part Programs Off LineChapter 66-3Use the Edit Part Program utility of ODS to edit part programs on aworkstation. Programs that already exist on the control can be uploaded tothe workstation for editing. These programs or programs created usingODS can be edited using the screen or text ed...

  • Page 174

    Editing Part Programs Off LineChapter 66-4The workstation displays this screen:F1 - FileF2 - ProjectF3 - ApplicationF4 - UtilityF5 - ConfigurationProj: DemoAppl: Part ProgramUtil: File ManagementFILE1 FILE2 FILE3Editing Part Program ...Selecting New or Existing FileUse ARROWS or Type in name.Pres...

  • Page 175

    Editing Part Programs Off LineChapter 66-5Use the configured screen or text editor to edit part programs. Theeditor must be compatible with the ODS operating system. Theeditor must be configured using the Text Editor Setup option of theF5-Configuration menu at the main menu line. For details on h...

  • Page 176

    Editing Part Programs Off LineChapter 66-6If the serial communication parameters of port B do not correspond to theserial communication parameters of the workstation, see yourprogramming manual.After using the part program edit utility to create or edit a part program fileoff line, the programmer...

  • Page 177

    Editing Part Programs Off LineChapter 66-74.Use the arrow keys to highlight the Download application then press[ENTER],or press [D].5.Press [F4]to pull down the Utility menu.F1 - FileF2 - ProjectF3 - ApplicationF4 - UtilityF5 - ConfigurationProj: DemoAppl: DownloadUtil: File ManagementSend AMP pa...

  • Page 178

    Editing Part Programs Off LineChapter 66-8F1 - FileF2 - ProjectF3 - ApplicationF4 - UtilityF5 - ConfigurationProj: DemoAppl: DownloadUtil: File ManagementDownload DestinationControl(C)(S)Storage7.Use the arrow keys to highlight the download destination or press theletter that corresponds to the d...

  • Page 179

    Editing Part Programs Off LineChapter 66-98.Use the arrow keys to highlight the name or type in the part programname to download, then press [ENTER].Important: It is possible to upload more than one part program byusing wildcards (“*” or “?”) in place of all or part of a file name.See the...

  • Page 180

    Editing Part Programs Off LineChapter 66-10Important: If you enter a wildcard in place of a file name, the Abortoption is repeated for each file that matches the wildcard. Pressingthe [ESC]key quits the abort wildcard process.After selecting the Rename or Overwrite option, or if the file beingdow...

  • Page 181

    Editing Part Programs Off LineChapter 66-11When the download process is complete, the workstation displaysthis screen:F1 - FileF2 - ProjectF3 - ApplicationF4 - UtilityF5 - ConfigurationProj: DemoAppl: DownloadUtil: Send Part ProgramDownload CompleteDownload Another File?YesNo(Y)(N)9.Select “Yes...

  • Page 182

    Editing Part Programs Off LineChapter 66-12The programmer can upload a part program from the control’s memory tothe workstation using the Upload application of ODS. This allows the partprogram to be edited or stored on the workstation.Important: Part programs in the protectable program director...

  • Page 183

    Editing Part Programs Off LineChapter 66-135.Press[F4] to pull down the Utility menu:F1 - FileF2 - ProjectF3 - ApplicationF4 - UtilityF5 - ConfigurationProj: DemoAppl: Part ProgramUtil: noneGet AMP paramsGet PAL and I/OGetPartProgram(A)(P)(R)6.Use the arrow keys to highlight the Get Part Program ...

  • Page 184

    Editing Part Programs Off LineChapter 66-147.Use the arrow keys to highlight the upload origin then press [ENTER]or press the letter that corresponds to the upload origin.The workstation displays the part program files that are stored on thecontrol or storage device:F1 - FileF2 - ProjectF3 - Appl...

  • Page 185

    Editing Part Programs Off LineChapter 66-15If the selected part program already exists on the workstation, theworkstation displays this screen:F1 - FileF2 - ProjectF3 - ApplicationF4 - UtilityF5 - ConfigurationProj: DemoAppl: UploadUtil: Get Part ProgramFile Already ExitsEnter OptionRename existi...

  • Page 186

    Editing Part Programs Off LineChapter 66-169.Type in the new name for the existing part program file on theworkstation.If you select this option:then:overwritethe part program file being uploaded overwrites the filehaving the same name on the workstation.abortthe upload process is discontinued an...

  • Page 187

    Editing Part Programs Off LineChapter 66-17After the part program has been uploaded to the workstation, theworkstation displays this screen:F1 - FileF2 - ProjectF3 - ApplicationF4 - UtilityF5 - ConfigurationProj: DemoAppl: UploadUtil: Get Part ProgramUpload CompleteUpload Another File?YesNo(Y)(N)...

  • Page 188

    Editing Part Programs Off LineChapter 66-18

  • Page 189

    Chapter77-1Running a ProgramThis chapter describes how to test a part program and execute it inautomatic mode. Major topics covered here include:Topic:On page:Selecting Special Running Conditions7-1Block Delete7-2Miscellaneous Function Lock7-2Sequence Stop {SEQ STOP}7-2Single Block7-4Selecting a ...

  • Page 190

    Running a ProgramChapter 77-2When programming a slash “/” followed by a numeric value (1-9)anywhere in a block, the control skips (not execute) all remaining motioncommands programmed commands in that block if a correspondingsoftkey or optionally installed switch on the MTB panel is activated...

  • Page 191

    Running a ProgramChapter 77-3To enter a sequence number to stop execution:1.Press the {PRGRAM MANAGE}softkey. A program must have alreadybeen selected for automatic execution as described on page 7-6.(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTFRONTPANELERRORMESAGEPASS-WO...

  • Page 192

    Running a ProgramChapter 77-4In single block mode, the control executes the part program block byblock. The control executes one block of commands in the part programwhen in single block mode each time you press the <CYCLE START>button.Figure 7.1Single BlockSINGLEBLOCKCYCLESTARTWhen you pre...

  • Page 193

    Running a ProgramChapter 77-5Before selecting a part program, you must tell the control where this partprogram is currently residing. You have 3 options:the program can reside in the control’s memorythe program can reside on a peripheral device attached to port A such asa tape reader (see your ...

  • Page 194

    Running a ProgramChapter 77-63.Press the softkey corresponding to the location the part program is tobe read from, {FROM PORT A}, {FROM PORT B},or {FROM MEMORY}.(softkey level 3)FROMPORT AFROMPORT BFROMMEMORYTo activate a part program, it must be selected as described on page 7-6for selecting a p...

  • Page 195

    Running a ProgramChapter 77-7Figure 7.2Part Program DirectoryACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMSELECTED PROGRAM:MAINDIRECTORYPAGE1OF1NAMESIZECOMMENTTESTAE3.9O123451.3SUB TEST 1MAIN1.3SHAFT21.3THIS IS A TEST PROGRAMXXX1.35 FILES137.8 METERS FREEImportant: Figure 7.2 shows pro...

  • Page 196

    Running a ProgramChapter 77-83.Key in the name of the part program to activate. If the program isbeing selected from the control’s memory, you can use the↑ or↓cursor keys to select the program to activate from the directoryscreen.If you select the part program from a peripheral device (atta...

  • Page 197

    Running a ProgramChapter 77-9To select a different part program for automatic execution, you mustdeactivate the part program that is currently active. To do this, followthese steps:1.Press the {PRGRAM MANAGE}softkey. The control displays theprogram directory screen as shown in Figure 7.2.(softkey...

  • Page 198

    Running a ProgramChapter 77-10Use the program search feature to begin program execution from someblock other than at the beginning of the program. This feature requires theoperator to establish the necessary G, M, S, F, and T words, workcoordinate offsets, etc. that should be active for that bloc...

  • Page 199

    Running a ProgramChapter 77-113.Press the {SEARCH}softkey.(softkey level 3)DE-ACTPRGRAMSEARCH MID STPRGRAMT PATHGRAPHSEQSTOPTIMEPARTS4.There are 6 different search options:(softkey level 4)NSEARCHOSEARCHEOBSEARCHSLEWSTRINGSEARCHNEXTPRGRAMIf you are searching for:Press this softkey:a sequence numb...

  • Page 200

    Running a ProgramChapter 77-12When using the N search, O search, or STRING search features, firstkey in the N number, O number, or character string to search for.After it has been keyed in, press the [TRANSMIT]keytostart thesearch.If you want to:Press this softkey:search for the entered value in ...

  • Page 201

    Running a ProgramChapter 77-13Use the mid-start program feature to begin program execution from someblock other than the first block of the program. This is done without theoperator knowing what G, M, T, work coordinate offsets, etc. should beactive for that block’s execution or to re-execute a...

  • Page 202

    Running a ProgramChapter 77-142.Press the {ACTIVE PRGRAM}softkey.REFORMMEMORYCHANGEDIRACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMVERFYPRGRAMPRGRAMCOMENTDELETEPRGRAMRENAMEPRGRAMINPUTDEVICE(softkey level 2)Make sure that the program to search is the currently active program.If it is no...

  • Page 203

    Running a ProgramChapter 77-155.Key in the desired character string or sequence number to search forand press the [TRANSMIT]key. The control locates an @ symbol tothe left of the block immediately before the block that automaticexecution begins from.If this is not the block to begin execution fro...

  • Page 204

    Running a ProgramChapter 77-16A message is generated telling the operator to check that all generatedmodal codes are correct. This message reads “WARNING - VERIFYMODAL CODES”. These modal codes should be checked on the G- orM-code status screen.The control begins program execution from the se...

  • Page 205

    Running a ProgramChapter 77-17Graphics are available on the active program graphics screen, see page8-24 for details.All of the above modes of execution begin program execution when youpress the <CYCLE START>button.If you see this to the left of the block:It means that the control:*is execu...

  • Page 206

    Running a ProgramChapter 77-18ATTENTION: Once axis reciprocation begins, it continuesthrough program block execution until stopped by a G80, anend of program (M02, M30, M99), a change to manual mode oran emergency stop. This means executing an M00 or an M01 ina part program does not necessarily s...

  • Page 207

    Running a ProgramChapter 77-19If you want to use the graphics feature, see page for QuickCheck withgraphics. To use the QuickCheck feature as described below withoutgraphics, the graphics option must be disabled.To use the QuickCheck feature:1.Select a program to check as described on page 7-6 an...

  • Page 208

    Running a ProgramChapter 77-20ATTENTION: When a program is run during quick checkmode, the control performs all coordinate system offsetoperations. This means that changes to the coordinate systemsor coordinate offset tables are made (G10 blocks, changes toG92 and G52 offsets, and changes to the ...

  • Page 209

    Running a ProgramChapter 77-21You can activate the axis inhibit feature by using a switch installed by yoursystem installer (see documentation provided by your system installer) or byusing the {FRONT PANEL}softkey (see page 2-11). The control must be incycle stop or E-Stop to activate or deactiva...

  • Page 210

    Running a ProgramChapter 77-22ATTENTION: Your system installer can write PAL to allowthe operator to select dry run at any time. This means thatduring normal automatic operation, the operator can selectmaximum cutting feedrate and replace all feedratesprogrammed with an F word with the AMP assign...

  • Page 211

    Running a ProgramChapter 77-23Figure 7.4Main Menu Screen in AUTO ModeE-STOPPROGRAM[ MM]F.000 MMPMRX00000.000T 1Z00000.000S 0MEMORY 30000 AUTOSTOPN 99999(First 4 blocks,of executing program shown here)(PAL messages)PRGRAMMANAGEOFFSET MACROPARAMQUICKCHECKSYSTEMSUPORTIn automatic mode, the control m...

  • Page 212

    Running a ProgramChapter 77-24Figure 7.5Automatic ModeS_____ M _____G92 X ____ Z ____T _________G00_________G01 F_______CYCLESTARTWORK PIECE123450Grinding wheel12009-IExecution of a part program continues until the control encounters an M02or M30. If the control does not encounter an M02 or M30 a...

  • Page 213

    Running a ProgramChapter 77-25ATTENTION: When you perform a program recover, thecontrol automatically returns the program to the beginning ofthe block that was originally interrupted.The beginning of the block is probably not the point that axismotion was interrupted.For absolute linear moves, th...

  • Page 214

    Running a ProgramChapter 77-26Important: DO NOT SELECT A PROGRAM AS AN ACTIVEPROGRAM. Do not disable the currently active program (if any).If a program is re-selected as active or disabled by the operator,the program restore feature is canceled.2.Press the {RESTRT PRGRAM}softkey. The control auto...

  • Page 215

    Running a ProgramChapter 77-27Use the jog retract feature to inspect, dress, or change the grinding wheelduring automatic program execution. It allows the grinding wheel to bejogged from the workpiece in multiple steps, and then returned to theworkpiece automatically by having the control retrace...

  • Page 216

    Running a ProgramChapter 77-284.Inspect and change the wheel or wheel offset as desired. Details onhow to do this are on page 3-4.5.After completing the desired inspection, dressing, or wheel change,press the <CYCLE START>button. Any wheel offset changes you havemade become active when the ...

  • Page 217

    Running a ProgramChapter 77-29In Figure 7.6, notice that the control only recognized 6 jog moves uponreturning instead of the actual 11 moves that were made to retract thewheel. This is because the jog retract feature records consecutive jogmoves on the same axis as one move.ATTENTION: If the num...

  • Page 218

    Running a ProgramChapter 77-30The block retrace function allows the operator to retrace the motion createdby up to 15 consecutive part program blocks. The actual number of retraceblocks allowed is set by your system installer in AMP, and can vary from 1to 15.Important: For maximum control efficie...

  • Page 219

    Running a ProgramChapter 77-31While block retrace is active, the control disables all jog features with theexception of <JOG RETRACT>. See page 7-27 for details on Jog Retract.MDI is not available to insert blocks during a block retrace operation.The block retrace function is unable to retr...

  • Page 220

    Running a ProgramChapter 77-32

  • Page 221

    Chapter88-1Display and GraphicsThe first part of this chapter gives a description of the different datadisplays available on the control. The second part gives a description ofthe control’s graphics capabilities.Pressing the [DISP SELECT]key displays the softkeys for selecting theaxis position ...

  • Page 222

    Displays and GraphicsChapter 88-2The screens described above may also show in addition to axis position:The current unit system being used (millimeters or inches)E-StopThe current feedrateThe current spindle speed of the controlling spindleThe current tool and tool offset numbersThe active progra...

  • Page 223

    Displays and GraphicsChapter 88-33.To return to softkey level 1, press the [DISP SELECT]key again. Themost recently selected data position screen will remain in effect forsoftkey level 1 until either power is turned off or a different positiondisplay screen is selected. The default screen selecte...

  • Page 224

    Displays and GraphicsChapter 88-4{PRGRAM} (Large Display)Axis position in the current work coordinate system displayed in largecharacters.Figure 8.2Results After Pressing {PRGRAM} (Large Display) SoftkeyPRGRAM ABSTARGETDTG AXISSELECTE-STOPPROGRAM[ MM](ACTIVE PROGRAM NAME)X-7483 .647Z-7483 .647U-7...

  • Page 225

    Displays and GraphicsChapter 88-5{PRGRAM} (Small Display)Axis position in the current work coordinate system displayed for allsystem axes in the active process (only available when more than 9 axis areAMPed in the system, or more than 8 axis in the process for dual processsystems).Figure 8.3Resul...

  • Page 226

    Displays and GraphicsChapter 88-6{ABS}The axis position data in the machine coordinate system.Figure 8.4Results After Pressing {ABS} SoftkeyE-STOPABSOLUTE[ MM]F0.000 MMPMX0.000S00Z0.000T 0U-0.035(ACTIVE PROGRAM NAME)MEMORYMANSTOPPRGRAM ABSTARGETDTG AXISSELECT

  • Page 227

    Displays and GraphicsChapter 88-7{ABS} (Large Display)Axis position in the machine coordinate system displayed in largecharacters.Figure 8.5Results After Pressing {ABS} (Large Display) SoftkeyPRGRAM ABSTARGETDTG AXISSELECTE-STOPABSOLUTE[ MM](ACTIVE PROGRAM NAME)X0.000Z0.000U-0.035F0.000 MMPM S00

  • Page 228

    Displays and GraphicsChapter 88-8{ABS} (Small Display)The axis position data in the machine coordinate system displayed for allsystem axes in the active process (only available when more than 9 axis areAMPed in the system, or more than 8 axis in the process for dual processsystems).Figure 8.6Resu...

  • Page 229

    Displays and GraphicsChapter 88-9{TARGET}The coordinate values of the end point of the currently executing axismove is displayed at a position in the current work coordinate system.Figure 8.7Results After Pressing {TARGET} SoftkeyTARGET[ MM]F0.000 MMPMX -7483.647S00Z -7483.647T 0U -7483.647(ACTIV...

  • Page 230

    Displays and GraphicsChapter 88-10{TARGET} (Large Display)The coordinate values in the current work coordinate system, of the endpoint of commanded axis moves in normal size characters.Figure 8.8Results after Pressing {TARGET} SoftkeyPRGRAM ABSTARGETDTG AXISSELECTE-STOPTARGET [ MM](ACTIVE PROGRAM...

  • Page 231

    Displays and GraphicsChapter 88-11{TARGET} (Small Display)The coordinate values of the end point of the currently executing axismove is displayed at a position in the current work coordinate system forall system axes in the active process (only available when more than 9 axisare AMPed in the syst...

  • Page 232

    Displays and GraphicsChapter 88-12{DTG}The distance from the current position to the command end point, of thecommanded axis in normal size characters.Figure 8.10Results After Pressing {DTG} SoftkeyE-STOPDISTANCE TO GO[ MM]F0.000 MMPMX0.021S00Z0.000T 0U0.000(ACTIVE PROGRAM NAME)MEMORYMANSTOPPRGRA...

  • Page 233

    Displays and GraphicsChapter 88-13{DTG} (Large Display)The distance from current position to the command end point of thecommanded axis move in large characters.Figure 8.11Results After Pressing {DTG} (Large Display) SoftkeyPRGRAM ABSTARGETDTG AXISSELECTDISTANCE TO GO[ MM](ACTIVE PROGRAM NAME)X0....

  • Page 234

    Displays and GraphicsChapter 88-14{DTG} (Small Display)The distance from the current position to the command end point, of thecommanded axis in normal size characters is displayed for all system axesin the active process (only available when more than 9 axis are AMPed inthe system, or more than 8...

  • Page 235

    Displays and GraphicsChapter 88-15{AXIS SELECT}Important: {AXIS SELECT}is available only during a large characterdisplay or when more than 9 axes are displayed on a normal size display.When you press {AXIS SELECT}, the control displays the axis names in thesoftkey area. Press a specific axis lett...

  • Page 236

    Displays and GraphicsChapter 88-16{M CODE STATUS}The currently active M codes are displayed. This screen indicates only thelast programmed M code in the modal group. It is the PAL programmersresponsibility to make sure proper machine action takes place when the Mcode is programmed.Figure 8.14Resu...

  • Page 237

    Displays and GraphicsChapter 88-17{PRGRAM DTG}This screen provides a multiple display of position information from theprogram screen and the distance to go screen.Figure 8.15Program, Distance to Go ScreenE-STOPPROGRAMDISTANCE TO GO[ MM ]X- 7483.647X0.031Y- 7483.647Y0.000Z- 7483.647Z0.000F0.000 MM...

  • Page 238

    Displays and GraphicsChapter 88-18{PRGRAM DTG} (Small Display)This screen provides a multiple display of position information from theprogram screen and the distance to go screen. It displays all system axes inthe active process (only available when more than 9 axis are AMPed in thesystem, or mor...

  • Page 239

    Displays and GraphicsChapter 88-19{ALL}This screen provides a multiple display of position information from theprogram, distance to go, absolute, and target screen. The all display isonly available on systems with 6 or less axes. On systems with more than6 axes, other combination screens are avai...

  • Page 240

    Displays and GraphicsChapter 88-20{G CODE STATUS}The currently active G-codes are displayed.Figure 8.18Results After Pressing {G CODE} SoftkeyPROGRAM STATUSPAGE2OF2G50.1MIRROR IMAGE CONTROLG64CUTTING MODEG67MACRO CALL CANCELG70INCH PROGRAMMINGG80CANCEL OR END FIXED CYCLEG90ABSOLUTEG94FEED/MING97C...

  • Page 241

    Displays and GraphicsChapter 88-21{SPLIT ON/OFF}The split screen softkey is only available if your system installer haspurchased the dual-process option.When you press the {SPLIT ON/OFF}softkey, you can view informationfor both processes. The screen displays two 40-column screens on one80-column ...

  • Page 242

    Displays and GraphicsChapter 88-22A large screen display makes it easier for you to see the axes.E-STOPPRGRAMABSTARGET DTGAXISSELECTPROGRAM [MM]PROGRAM [MM]<FRONT TURRET><REAR TURRET>0.000X0.000X0.000ZF0.000IPMSOF0.000IPMSOIf desired the system installer has the option of configuring ...

  • Page 243

    Displays and GraphicsChapter 88-23When changing the value of some parameter on the PAL display page, partprogram execution is not typically interrupted. If some data that is used ina currently executing part program is changed the control will handle thatdata in the following manner:If the parame...

  • Page 244

    Displays and GraphicsChapter 88-249/240 CNCsThe 9/240 control is equipped to display four languages. The languagesavailable and the order they are displayed are fixed in this order:EnglishItalianJapaneseGermanQuickCheck and active program graphics function similarly. They bothplot tool paths. The...

  • Page 245

    Displays and GraphicsChapter 88-252.Select a program. Press {SELECT PRGRAM}.(softkey level 2)SELECTPRGRAMQUICKCHECKSTOPCHECKT PATHGRAPHT PATHDISABL3.Use the up and down cursors to select a program.4.Press {ACTIVE PRGRAM}to return to level 2 and activate the program.Follow these steps to run graph...

  • Page 246

    Displays and GraphicsChapter 88-26The control for both QuickCheck and active graphics continues to plot toolpaths, even if the graphics screen is not displayed. Actual display of thetool paths is only possible on the graphics screen. When the graphicsscreen is displayed again, any new tool motion...

  • Page 247

    Displays and GraphicsChapter 88-27In some cases, you may want to operate without graphics. For example,you cannot edit a part program using QuickView while in graphics, or youmay want to speed up processing by disabling graphics.To disable graphics, press the appropriate softkey:(softkey level 2)...

  • Page 248

    Displays and GraphicsChapter 88-28You may want to change the parameters to alter your graphics. If you wantto view a different graphics screen, you must change the default values forthe parameters. These are the default parameter values for QuickCheck:PROCESS SPEED:[FAST]RAPID TRAVERSE:[ON]AUTO S...

  • Page 249

    Displays and GraphicsChapter 88-292.Set Select Graph. Use the up and down cursor keys to select theaxes. Then set them by pressing the left or right cursor keys. Thedata for the selected axes change each time you press the left or rightcursor key.A pictorial representation of the selected graph, ...

  • Page 250

    Displays and GraphicsChapter 88-304.Set Auto Size. Use the up and down cursor keys to select theparameter. Set auto size by pressing the left or right cursor keys. Thevalue for the selected parameter changes each time you press the leftor right cursor key.If you turn this parameter “ON”, the ...

  • Page 251

    Displays and GraphicsChapter 88-317.Set the Main Program Sequence Starting #: parameter. It is onlyavailable with QuickCheck. Use the up and down cursors to selectthis parameter. Set it by typing in the new value for that parameterusing the keys on the operator panel. Press the [TRANSMIT]key when...

  • Page 252

    Displays and GraphicsChapter 88-329.Set the Process Speed parameter. It is only available withQuickCheck. Use the up and down cursors to select this parameter.Set it by pressing the left or right cursor keys. The data for theselected parameter changes each time you press the left or rightcursor k...

  • Page 253

    Displays and GraphicsChapter 88-33The active and QuickCheck graphics features can run in single-block orcontinuous mode as described in chapter 8.In:This happens:Single blockone block of a part program executes each time you press the<CYCLE START>.Continuous modethe control continues to exe...

  • Page 254

    Displays and GraphicsChapter 88-34Figure 8.19Zoom Window Graphic Display Screen.INCRWINDOWDECRWINDOWZOOMABORTZOOM20.015.611.16.72.2-2.2-6.7X-11.1-15.6-20.0-20.0-10.3 Z -0.59.218.927.738.448.157.9This screen resembles the regular QuickCheck graphics screen with theexception that it includes a wind...

  • Page 255

    Displays and GraphicsChapter 88-35To use the zoom window feature:1.Press the {ZOOM WINDOW}softkey. This changes the display to thezoom window display.(softkey level 3)CLEARGRAPHSMACHNEINFOZOOMWINDOWZOOMBACKGRAPHSETUP2.Use the cursor keys on the operator panel to move the center of thewindow aroun...

  • Page 256

    Displays and GraphicsChapter 88-363.To change the size of the window, use the {INCR WINDOW}or{DECR WINDOW}softkeys. To change the window size at a faster rate,press and hold the [SHIFT]key while pressing the {INCR WINDOW}or{DECR WINDOW}softkeys.Each time you press:The Zoom Window :{INCR WINDOW}in...

  • Page 257

    Displays and GraphicsChapter 88-37When power is turned on, the control displays the power turn-on screen.The following section discusses how to modify information displayed onthis screen at power up.Editing the System Integrator Message LinesTo edit the system integrator message lines of the powe...

  • Page 258

    Displays and GraphicsChapter 88-384.Press the {ENTER MESAGE}softkey. This highlights the softkey, andthe control displays the input prompt “PTO MESSAGE:” at the top ofthe screen. Also, the current text, if any, of the selected message lineis shown on the input line next to the prompt. (The te...

  • Page 259

    Displays and GraphicsChapter 88-39The 9/Series screen saver utility is designed to reduce the damage done tothe CRT from “burn in”. Burn in is the result of the same lines orcharacters being displayed at the same location on the screen for a such along period of time that they leave a permane...

  • Page 260

    Displays and GraphicsChapter 88-402.Press the [SCREEN SAVER] softkey.PRGRAMPARAMPTOMSI/OEMAMPDEVICESETUPMONI-TORTIMEPARTSSYSTEMTIMING(softkey level 2)SCREENSAVERThe screen saver setup screen appears.SCREEN SAVERACTIVATION TIMER : 05 MINUTESSAVERON/OFFINCRTIMERDECRTIMERPress This SoftkeyTo:SAVER O...

  • Page 261

    Chapter99-1CommunicationsThis chapter contains this information:Topic:On Page:Setting Communications9-1Setting Communication Port Parameter Values9-1Communication Port Parameters9-3Inputting Part Programs from a Tape Reader9-9Outputting Part Programs to a Tape Punch9-13Verifying Part Programs Aga...

  • Page 262

    CommunicationsChapter 99-22.Press the {DEVICE SETUP} softkey to display the device setupscreen as shown in Figure 9.1.(softkey level 2)PRGRAMPARAMAMPDEVICESETUPMONI-TORTIMEPARTSPTOMSI/OEMSYSTEMTIMINGFigure 9.1Device Setup ScreenE-STOPSERIAL PORT:ADEVICE:DECITEK AB 8000-XPDRPORT TYPE:RS232BAUD RAT...

  • Page 263

    CommunicationsChapter 99-33.Use the up and down cursor keys to move the cursor to the parameteryou want to change. The current value for each parameter appears inreverse video.4.To change a value after a parameter has been selected, press the leftor right cursor keys. The control scrolls through ...

  • Page 264

    CommunicationsChapter 99-4DEVICE (setting type of peripheral)Select your peripheral device immediately after selecting your serial port.The devices with default communication parameters stored in the controlare listed in Table 9.A. If the device that you are using is not listed, selectUSER PUNCH,...

  • Page 265

    CommunicationsChapter 99-5BAUD RATEYou can set the baud rate at these speeds (in bits per second):300, 600, 1200, 2400, 4800, 9600, 19200See the documentation provided with your peripheral device.MAXIMUM BAUD RATEIf you need to operate your 9/Series control at a baud rate higher than9600 bps, you...

  • Page 266

    CommunicationsChapter 99-6PARITY (parity check)Select the parity from the following parity check schemes:ParityParity CheckNONENo parity checkEVENEven parityODDOdd paritySee the documentation provided with your peripheral device.STOP BIT (number of stop bits)Select the number of stop bits with th...

  • Page 267

    CommunicationsChapter 99-7OUTPUT CODESelect EIA (RS-244A) or ASCII (RS-358-B) as output codes for deviceswith data lengths configured as 8 bit. The output code can not beconfigured for data lengths configured as 7 bits and is displayed as N/A.AUTO FILENAMEThis parameter is valid only if you are i...

  • Page 268

    CommunicationsChapter 99-8reached. See the PROGRAM END section to determine what defines theend-of-program for your system.SettingResultYesthe tape reader stops every time it encounters a program end code.Nothe tape reader stops only if it encounters an error condition or the end of tapecode.CAUT...

  • Page 269

    CommunicationsChapter 99-9PRGRM NAME -- if set to “yes,” a program name is recognized as theend of the previous program. The program name must be in one ofthese forms where xxxxx indicates an integer from 0 to 99999:Oxxxxx(ASCII):xxxxx(EIA)Nxxxxx(except for N00000)Important: If you use an N-c...

  • Page 270

    CommunicationsChapter 99-10SELECTED PROGRAM:DIRECTORYPAGE1OF1NAMESIZECOMMENTO123451.3SUB TEST 1TEST3.9NEWMAIN1.3TTTE1.3THIS IS A TEST PROGRAMXXX1.35 FILES120.7METERS FREEACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAM3.Select the directory into which you want the program to be copied.You...

  • Page 271

    CommunicationsChapter 99-115.If you have already entered the name in the program, skip step 5. andgo to step 6. Otherwise, enter the program name to copy by eitherselecting it using the up and down cursor keys or typing it in by usingthe alphanumeric keys on the keyboard. The control displays the...

  • Page 272

    CommunicationsChapter 99-127.Specify if you want to copy one program or multiple programs.Input Single ProgramPress {SINGLE PRGRAM} to copy one program from tape.Input terminates when the first program end or tape end code isencountered.Input Multiple ProgramsPress {MULTI PRGRAM} to copy multiple...

  • Page 273

    CommunicationsChapter 99-13If a program is in control memory and you want to send a copy of thatprogram to a peripheral device, follow these steps:1.Verify that the peripheral device is connected to the correct serial portand that the port is configured for that device (see page 9-4).2.Press the ...

  • Page 274

    CommunicationsChapter 99-143.Press the {COPY PRGRAM} softkey.(softkey level 2)ACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMVERIFYPRGRAMPRGRAMCOMENTDELETEPRGRAMRENAMEPRGRAMINPUTDEVICEREFORMMEMORYCHANGEDIR4.Enter the program name to output from memory. Two ways to do thisare available:Ty...

  • Page 275

    CommunicationsChapter 99-15Output Multiple ProgramsPress {MULTI PRGRAM} to output more than one program.After you pressed the {MULTI PRGRAM} key, the programselected in step 4 is output. The program directory screen (seeFigure 9.3) appears with the following set of softkeys:(softkey level 4)OUTPU...

  • Page 276

    CommunicationsChapter 99-16(softkey level 3)SINGLEPRGRAMMULTIPRGRAMOUTPUTALLFigure 9.4Copy Parameters ScreenCOPY PARAMETERSFROM:(Program Name)TO:(Selected Port Name)DEVICE:FACIT N4000BAUD RATE:2400PROTOCOL:LEVEL_2*OUTPUT CODE:ASCIIAUTO FILENAME:NOSTOP PRG END:YESPROGRAM END:M02, M30M99CANCELImpor...

  • Page 277

    CommunicationsChapter 99-17(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTFRONTPANELERRORMESAGEPASS-WORDSWITCHLANG3.Press the {VERIFY PRGRAM} softkey.REFORMMEMORYCHANGEDIRACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMVERIFYPRGRAMPRGRAMCOMENTDELETEPRGRAMRENAMEPRGRAM...

  • Page 278

    CommunicationsChapter 99-186.Press the {VERIFY YES} softkey. To abort the verify operation,press the {VERIFY NO} softkey.(softkey level 4)VERIFYYESVERIFYNOThe control displays one of the following messages when you perform theverify operation:“PROGRAMS ARE DIFFERENT” if programs do not match....

  • Page 279

    Chapter1010-1Introduction to ProgrammingThis chapter covers an introduction to programming part programs. Themajor topics described in this chapter include:Topic:On page:Tape Format10-2Program Configuration10-6Program Names10-8Sequence Numbers10-9Comment Blocks10-10Block Delete and Multi Level De...

  • Page 280

    Introduction to ProgrammingChapter 1010-2You can execute part programs from the control’s memory or a CNC tape.You can execute programs on tape directly from the tape, or load them intothe control and execute them from memory.This chapter begins with an explanation of CNC tape format. Theremain...

  • Page 281

    Introduction to ProgrammingChapter 1010-3Figure 10.1Tape Configuration (Program End = M02, M30, M99)ERor%EOBProgram start codeLeadersectionTape startcodeEOBPart programProgramend codeTape endcode1 footspaceEOBO100Programname (opt)O101Programname(opt)Programend codePart programM30M99Comment(opt)EO...

  • Page 282

    Introduction to ProgrammingChapter 1010-4The control automatically recognizes EIA or ASCII during input when itreads the first EOB code from the tape.(1) Tape Start (Rewind, Stop Code)The tape start code, indicating the beginning of a tape, is designated with:% character ---- ASCII formatER ---- ...

  • Page 283

    Introduction to ProgrammingChapter 1010-5(4) O Word Program NameThe program name, if on the tape, must follow the program start code.When outputting to tape, the program name can be determined by:Program Name:If:Manually keying in the program name-- --Selected from the first block of theprogramNo...

  • Page 284

    Introduction to ProgrammingChapter 1010-6The comment can be up to 128 characters long (including the control outand control in codes), and can consist of any alphanumeric characters andspecial symbols. However, the comment cannot include the followingcodes:()ER, %(rewind stop codes)EOB(end of blo...

  • Page 285

    Introduction to ProgrammingChapter 1010-7words ---- A word consists of an address followed by a numeric value.Examples of words are: G01, X10.5, F.1., M2. Each word requires aspecific format for its numeric part. These formats are given on page10-21.codes ---- There are industry standards for man...

  • Page 286

    Introduction to ProgrammingChapter 1010-8The blocks programmed vary for each section of the program. ConsiderExample 10.2.Example 10.2Sample Part ProgramG91G21;G00X28.;G81Z5.K-2.;G00X5;G80;M02;beginningmiddleendA complete part program can consist of a main program and severalsubprograms. For deta...

  • Page 287

    Introduction to ProgrammingChapter 1010-9Entering Program NamesTo enter a program name, do the following:1.Press the softkey {PRGRAM MANAGE}. This calls up the programdirectory, which lists subprograms first, then programs byalphabetical order.2.Type in the name of a new program or one already li...

  • Page 288

    Introduction to ProgrammingChapter 1010-10Example 10.5 shows two blocks with sequence numbers 10000 and 10010.Example 10.5Blocks With Sequence NumbersN10000 X5.Z4.;N10010 X2.Z2.;Typically when assigning sequence numbers to blocks, the N word comesfirst in the block except when designating block d...

  • Page 289

    Introduction to ProgrammingChapter 1010-11When programming a slash “/” followed by a numeric value (1-9)anywhere in a block, the control skips (does not execute) all remainingprogrammed commands if you turn on the block delete feature. Turn onthis feature by pressing the {FRONT PANEL} softkey...

  • Page 290

    Introduction to ProgrammingChapter 1010-12All program blocks must have an end of block statement as the lastcharacter in the block. This character tells the control how to separate datainto blocks. The control uses the “;” to mark the end of a block.To specify an end of block character “;...

  • Page 291

    Introduction to ProgrammingChapter 1010-13Generally the control executes programs sequentially. When you enter anM98Pnnnnn (“nnnnn” representing a subprogram number) command in aprogram, the control merges the subprogram, designated by the address P,with the main program immediately before th...

  • Page 292

    Introduction to ProgrammingChapter 1010-14The M99 code acts as a return command in both subprograms and mainprograms; however, there are specific differences:If you use M99 in a:M99:main program• executes all commands in the block, regardless of if information isprogrammed in the block to the r...

  • Page 293

    Introduction to ProgrammingChapter 1010-15Example 10.8Subprogram Calls and Returns (continued)The following path of execution results when the main program above isselected as the active program.(MAIN PROGRAM);N00010...;N00020...;N00030M98P1;(SUBPROGRAM 1);N00110;N00120...;N00130M99;N00040...;N00...

  • Page 294

    Introduction to ProgrammingChapter 1010-16Figure 10.3Subprogram NestingMainprogramSub-program 1Sub-program 2Sub-program 3Sub-program 4Level 1Level 2Level 3Level 4M02;pM99;M99;M99;M99;M98P11111;M98P22222;M98P33333;M98P44444;0 00001;0 11111;0 22222;0 33333;0 44444;12015-IImportant: Calling a macro ...

  • Page 295

    Introduction to ProgrammingChapter 1010-17Words in a part program consist of addresses and numeric values:Address ---- A character to designate the assigned word functionNumeric value ---- A numeral to express the event called out by thewordFigure 10.4Word ConfigurationWordWordG01X1.3 1AddressNum...

  • Page 296

    Introduction to ProgrammingChapter 1010-18Table 10.AHow the Control Interprets Numeric ValuesPosition Interpreted by the controlProgrammed X ValueTZS DisabledLZS DisabledTZS DisabledLZS EnabledTZS EnabledLZS DisabledX123456.ERRORERRORERRORX12345.612345.6012345.6012345.60X1234.561234.561234.561234...

  • Page 297

    Introduction to ProgrammingChapter 1010-19Later sections describe these words in more detail, including variations intheir meanings when they are associated with certain G codes. All wordsdescribed in this manual assume the formats and addresses in the followingtable have not been changed by your...

  • Page 298

    Introduction to ProgrammingChapter 1010-20AddressFunctionValid RangemetricValid RangeinchS5.33.34.35.33.33.3Spindle rpm functionSpindle OrientCSST6.06.0Tool selection functionU5.35.3Length of dwell in G04 and fixed cycles.X8.65.38.55.3Main axis (AMP assigned)Length of dwell in G04Y8.68.5Main axis...

  • Page 299

    Introduction to ProgrammingChapter 1010-21This section describes general features of the words used in programming.Later chapters in this manual describe in detail how to use these words.Axis words are made up of an axis name followed by the desired numericvalue for that word.For axis names, the ...

  • Page 300

    Introduction to ProgrammingChapter 1010-22An F word with numeric values specifies feedrates for the grinding anddressing moves in linear interpolation (G01), and circular interpolation(G02/G03) modes. The feedrate is the speed along a vector of thecommanded axes, as shown in Figure 10.5.Figure 10...

  • Page 301

    Introduction to ProgrammingChapter 1010-23In a metric part program for a linear axis, a feedrate of 100 millimeters perminute (mmpm) typically would be written as F100.; (depending on theactive word format).For details on programming feedrates using the different feedrate modesand special pre-ass...

  • Page 302

    Introduction to ProgrammingChapter 1010-24Example 10.9Programming Modal G codesG00 X1. Z2.;G00 mode is effectiveZ3. ;G00 mode is effectiveG01 X2. Z1. ;G01 mode is made effectiveX3. Z3. ;G01 mode is in effectG00 X1.Z2. ;G00 mode becomes effective againG01 G00 Z3, ;G00 mode is in effectG01 G91 Z2 ;...

  • Page 303

    Introduction to ProgrammingChapter 1010-25Table 10.EG Code TableSurfaceGrinderCylindricalGrinderGroupNumberFunctionModal orNon-modalG00G0001Rapid PositioningModalG01G01Linear interpolationG02G02Circular / helical interpolation CWG03G03Circular / helical interpolation CCWG04G0400DwellNon-modalG05G...

  • Page 304

    Introduction to ProgrammingChapter 1010-26SurfaceGrinderModal orNon-modalFunctionGroupNumberCylindricalGrinderG23G2304Programmable Zone 2 and 3 (Off)ModalG23.1G23.1Programmable ZoneG24G2401Single pass rough facing cycleG27G2700Machine home return checkNon-modalG28G28Automatic return to machine ho...

  • Page 305

    Introduction to ProgrammingChapter 1010-27SurfaceGrinderModal orNon-modalFunctionGroupNumberCylindricalGrinderG59.3G59.312Preset Work Coordinate System 9ModalG61G6113Exact stop modeG62G62Automatic corner override modeG64G64Cutting modeG65G6500Paramacro CallNon-modalG66G6614Modal paramacro callMod...

  • Page 306

    Introduction to ProgrammingChapter 1010-28SurfaceGrinderModal orNon-modalFunctionGroupNumberCylindricalGrinder-- --G88.109Diameter plunge shoulder cycle with predress-- --G89Multi-step plunge with blend-- --G89.1Multi-step plunge with blend and predressG90G9003Absolute modeModalG91G91Incremental ...

  • Page 307

    Introduction to ProgrammingChapter 1010-29The miscellaneous function is designated with an address M followed by atwo or three-digit numeric value. Because many of these are set byindustry standards, they are usually referred to as M codes.When a miscellaneous function is designated in a block co...

  • Page 308

    Introduction to ProgrammingChapter 1010-30Table 10.FBasic M CodesM CodeNumberModal ornon-ModalGroupNumberFunctionM00NM4Program stopM01NM4Optional program stopM02NM4Program endM30NM4Program end and reset (tape rewind)SPINDLE 1M03M7Spindle positive rotation (cw)M04M7Spindle negative rotation (ccw)M...

  • Page 309

    Introduction to ProgrammingChapter 1010-31The following describes the basic M codes provided with the control.(1) Program Stop (M00)When the control executes M00, program execution is stopped after theblock containing the M00 is executed. At this time, the CRT displays the“PROG STOP” message....

  • Page 310

    Introduction to ProgrammingChapter 1010-32(4) End of Program, Tape Rewind (M30)If you execute a program from control memory, the M30 code acts thesame as an M02. The control stops program execution and enters the cyclestop state. The program is reset to the first block and a <CYCLE START>be...

  • Page 311

    Introduction to ProgrammingChapter 1010-33(8) Constant Surface Speed Mode Disabled (M59)M59 cancels M58 and G96 making the constant surface speed modeineffective. The spindle continues to revolve at the speed it was at themoment the M59 executed.The spindle speed can be directly programmed using ...

  • Page 312

    Introduction to ProgrammingChapter 1010-34Important: When the miscellaneous function lock feature is activated, thecontrol ignores M, B, S, and T words in the part program with theexception of M00, M01, M02, M30, M98, and M99. This feature isdescribed on page 7-2.2nd Miscellaneous Function (B Wor...

  • Page 313

    Introduction to ProgrammingChapter 1010-35When you repeat the same series of blocks more than once, we recommendthat you program them using a subprogram.This section explains the following:1) Main and subprograms2) Subprogram callsImportant: To make jumps, loops, or calculations within an executi...

  • Page 314

    Introduction to ProgrammingChapter 1010-36When programming an S word in a block that contains axis motioncommands, the PAL program has the option to temporarily suspend theaxis motion commands until the spindle reaches speed. The control cansearch for and select the appropriate gear range to atta...

  • Page 315

    Introduction to ProgrammingChapter 1010-37Important: When the miscellaneous function lock feature is activated, thecontrol ignores M, B, S, and T words in the part program with theexception of M00, M01, M02, M30, M98, and M99. This miscellaneousfunction lock feature is activated through the front...

  • Page 316

    Introduction to ProgrammingChapter 1010-38From Table 10.G, you can see you cannot program a T word withoutinadvertently programming both a length offset and a radius/orientationoffset. By not programming one of the offsets, the control assumes anoffset of 00 is programmed and cancels any active o...

  • Page 317

    Chapter1111-1Coordinate ControlThis chapter describes the control of the coordinate systems on the control.G words in this chapter are among the first programmed because theydefine the coordinate systems of the machine in which axis motion isprogrammed.Topic:On page:Machine (Absolute) Coordinate ...

  • Page 318

    Coordinate ControlChapter 1111-2The control has two types of coordinate systems:machine coordinate system. This is often referred to as the absolutecoordinate system, which is unique to the individual grinding machinework coordinate system. This is defined based on the coordinatesystem used in th...

  • Page 319

    Chapter 11Coordinate Control11-3In Figure 11.1, your system installer has defined the zero point of themachine coordinate system by assigning the machine home point to havethe coordinates X=10 and Z=15 in the machine coordinate system.Important: The coordinate values assigned to the machine home ...

  • Page 320

    Coordinate ControlChapter 1111-4Example 11.1Motion in the Machine Coordinate SystemProgram blockCommentN1 G00X30Z30;axis motion in work coordinate system.N2 G53X25Z10;axis motion in machine coordinate system.N3 X20Z50;axis motion in work coordinate system.Figure 11.2Results of Example 11.1N2N3N1W...

  • Page 321

    Chapter 11Coordinate Control11-5Figure 11.3Work Coordinate SystemZero point onthe part drawingWorkpieceChuckWorkpieceZero point on the workcoordinate systemWheel position atmachine coordinate zero pointZ DistancetobeassignedX Distance to be assigned12016-IThere are 9 preset work coordinate system...

  • Page 322

    Coordinate ControlChapter 1111-6Figure 11.4Work Coordinate System DefinitionMachine coordinate systemMachine homeG54 Work coordinate system2-3-23XXZZ12170-IIn Figure 11.4, the machine coordinate system was defined by declaringthe fixed position machine home as the point X=-2., Z=-3. Then the G54w...

  • Page 323

    Chapter 11Coordinate Control11-7To change work coordinate systems, specify the G code corresponding tothe work coordinate system in a program block. Any axis motioncommands in a block that contains a change from one work coordinatesystem to another are executed in the work coordinate system speci...

  • Page 324

    Coordinate ControlChapter 1111-8There are 3 methods to change the value of a work coordinate system zeropoint in the work coordinate system table. You can find two methods inthese chapters:Method:Chapter:Manually alter the work coordinate system table3Alter the paramacro system parameter values 5...

  • Page 325

    Chapter 11Coordinate Control11-9Incremental/Absolute Mode and the G10L2 CommandWhen you program in incremental mode (G91), any values entered intothe work coordinate system table using the G10 command are added to thecurrently active work coordinate system values. When you program inabsolute mode...

  • Page 326

    Coordinate ControlChapter 1111-10The external offset allows all work coordinate system zero points to beshifted simultaneously relative to the machine coordinate system. Thisoffset can compensate for part positioning shifts that result when adifferent chuck or mandrel is installed.Also, use the e...

  • Page 327

    Chapter 11Coordinate Control11-11There are 3 methods to change the value of an external offset in the workcoordinate system table. Two methods can be found in the followingchapters:Method:Chapter:Manually alter the external offset value in the work coordinate systemtable3Alter the paramacro syste...

  • Page 328

    Coordinate ControlChapter 1111-12Example 11.4Changing the External Offset Through G10 ProgrammingProgram BlockCommentsG10L2P1O1X-15.Z-10.;defines work coordinate system zeropoint to be at X-15, Z-10 from themachine coordinate system zero pointG90;G10L2P0O1X-15.Z-20.;sets external offset of X-15, ...

  • Page 329

    Chapter 11Coordinate Control11-13This section describes the more temporary ways of offsetting the workcoordinate systems. These offsets are activated through programming andare canceled when a control reset is performed, or power to the control isturned off. These offsets can also be canceled whe...

  • Page 330

    Coordinate ControlChapter 1111-14Use the G92 command in a part program to offset the currently active workcoordinate system relative to the current wheel position. A G92 block in aprogram offsets the zero point of the work coordinate system a specifieddistance from the current wheel position.G92....

  • Page 331

    Chapter 11Coordinate Control11-15Example 11.5Work Coordinate System Offset (G92)Program BlockCommentG54 G00;G54 work coordinate system.X35. Z25.;RapidmovetoX35, Z25inthe G54work coordinate system.G92X10.Z10.;Redefines current axis position to havethe coordinates X10, Z10The zero point of the offs...

  • Page 332

    Coordinate ControlChapter 1111-16Example 11.6 shows the effect of changing work coordinate systems whilethe G92 offset is active:Example 11.6Changing Work Coordinate Systems With Offset ActiveProgramCommentN1 G10L2P1X0Z0;Define G54 work coordinate system zero point to be positionedX0, Z0 away fro...

  • Page 333

    Chapter 11Coordinate Control11-17To offset a work coordinate system an incremental amount from its zeropoint, program a G52 block that includes the axis names and distances tobe offset.G52 X___ Z___ ;The above command offsets the current work coordinate system by theaxis values that follow the G5...

  • Page 334

    Coordinate ControlChapter 1111-18A G52 offset can also be canceled by executing a G92 or G92.1,performing a control reset or an E-STOP reset operation, or executing anend of program M30 or M02. A G92 command only cancels a G52 offsetif one is active when the G92 block is executed. A G52 offset ca...

  • Page 335

    Chapter 11Coordinate Control11-19Example 11.8Typical Set Zero Offset ApplicationOperationComment-Manual jog-axes are manually jogged to a location where the operator hasdetermined that a special operation must be performed.-Set Zero-operator performs a Set Zero offset to establish the work coordi...

  • Page 336

    Coordinate ControlChapter 1111-20To use this feature, follow these directions:1.Turn on the switch to activate the jog offset function (seedocumentation provided by your system installer).2.Change to manual mode unless the control is equipped for the “Jogon the Fly” feature, which allows jogg...

  • Page 337

    Chapter 11Coordinate Control11-21You must program the G92.1 block with no axis words. Axis words in aG92.1 block generates an error. When the control executes the G92.1block, the control cancels all G92, G52, {SET ZERO}, and Jog offsets onall axes. You cannot cancel the offsets on individual axes...

  • Page 338

    Coordinate ControlChapter 1111-22The G92.2 command cancels these offsets:G92 work coordinate system offset{SET ZERO} offsetJog offsetG92.2 does not cancel an external offset (see page 11-10), reset the currentwork coordinate system (G54-G59.3) or cancel a G52 offset.You must program the G92.2 blo...

  • Page 339

    Chapter 11Coordinate Control11-23The control has a feature (G68) that can rotate the work coordinate system.Another feature, external part rotation, rotates all work coordinate systemsby simulating a rotation of the machine coordinate system. Rotating thecoordinate systems can prove to be useful ...

  • Page 340

    Coordinate ControlChapter 1111-24To rotate the current work coordinate system, program this command:G68 X__ Z__ R__;Where :Is:X, Zthe center of rotation using only the two axis words that are in the current activeplane (G17, G18, or G19). The value entered with these axis words represent apositio...

  • Page 341

    Chapter 11Coordinate Control11-25Example 11.10Rotating the Current Work Coordinate SystemThese program blocks cause the rotation of the active work coordinatesystem as shown in Figure 11.15.ABSOLUTE PROGRAMINCREMENTAL PROGRAMN1 G54 G17 G00;N1 G54 G17 G90;N2 G90 Z0. X0. F500;N2 G00 Z0. X0.;/N3 G68...

  • Page 342

    Coordinate ControlChapter 1111-26In Figure 11.15, the center of rotation programmed in the G68 block isignored when the block immediately following the G68 is an incrementalmotion block.Angles and centers of rotation for G68 blocks are modal and remain ineffect for following G68 blocks until a ne...

  • Page 343

    Chapter 11Coordinate Control11-27Example 11.11Canceling G68 Rotations With G69Program BlockCommentN01 G54;N02 G68Z0X0R10;Rotates the current work coordinate system 10°.N03 G68Z5.X4.R30;Rotates the current work coordinate system 30° about a center point of Z5., X4. for atotal rotation from its o...

  • Page 344

    Coordinate ControlChapter 1111-28Example 11.12Rotating the Work Coordinate System with G52Main ProgramSubprogram 1000G17 G90 G00 Z0 X0;G01 Z45. X15. F500.;G00 G90 Z40 X45.;Z65.;M98 P1000 L4;Z70. X45.;M30;G68 Z55. X60. R90.;M99;Figure 11.17Results of Example 11.12Center ofrotation after G52Initial...

  • Page 345

    Chapter 11Coordinate Control11-29External Part Rotation can be executed before or after rotation of the workcoordinate system using the G68 command, see page 11-24. If a G68 isprogrammed to rotate the current work coordinate system, an additionalrotation of coordinates result as shown in Figure 1...

  • Page 346

    Coordinate ControlChapter 1111-30Activating the External Part Rotation FeatureTo activate the external part rotation feature, follow these steps:1.Place the control in E-STOP and press the {OFFSET} softkey.(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTFRONTPANELERRORMESAGEP...

  • Page 347

    Chapter 11Coordinate Control11-313.Move the cursor to the parameter you want to change by pressing theup, down, left, right cursor keys. The selected parameter appears inreverse video.4.Enter the new value for the parameter by using the keys on thekeyboard. The entered value appears on the input ...

  • Page 348

    Coordinate ControlChapter 1111-32CENTERUse this parameter to assign the center of rotation. The center of rotationis a point on the machine coordinate system about which all the workcoordinate systems are rotated. Enter a coordinate value for each axis inthe selected plane. The default value for ...

  • Page 349

    Chapter 11Coordinate Control11-33The control has a number of features that operate in specific planes. Forthat reason, it is frequently necessary to change the active plane using aG17, G18, or G19 code.This is especially true for surface grinding machines. Cylindrical grindersare generally limite...

  • Page 350

    Coordinate ControlChapter 1111-34Example 11.13Altering Planes for Parallel AxesAssuming the system installer has made these assignments in AMP:G18-- the ZX planeW axis -- parallel to Z axisU axis -- parallel to X axisProgram BlockPlane SelectedAxis MotionG18;selects ZX planenoneG18 U;selects ZU p...

  • Page 351

    Chapter 11Coordinate Control11-35Figure 11.19Overtravel Areas and Programmable ZonesZ axis travelLimit switchHardwareovertravelSoftwareovertravelProgrammablezone 3Programmablezone 2GrindingwheelLimit switchLimit switchXaxistravelLimit switch12021-ITwo types of overtravels are available:Hardware o...

  • Page 352

    Coordinate ControlChapter 1111-36When the grinding machine is set up, your system installer should haveinstalled a set of two mechanical limit switches on each axis. These limitswitches are installed in a position such that when the machine attempts tomove beyond a range determined by your system...

  • Page 353

    Chapter 11Coordinate Control11-37Your system installer selects values that represent a maximum and aminimum value in the form of coordinate values for each axis. Thesecoordinate values define points on the machine coordinate system. Theaxes are then not allowed to move past the coordinate value r...

  • Page 354

    Coordinate ControlChapter 1111-38Programmable zone 2 defines an area which the grinding wheel cannotenter. Generally, you use zones to protect some vital area of the machineor part located within the software overtravels.Important: Programmable zones are defined using coordinates in themachine co...

  • Page 355

    Chapter 11Coordinate Control11-39Programmingthis G-code:turns Zone 2:turns Zone 3:G22OnOnG22.1OffOnG23OffOffG23.1No Change*Off* A G23.1 turns on programmable zone 2 if it is the defaultpower up condition configured in AMP (also activated at acontrol reset). G23.1 does not turn on programmable zon...

  • Page 356

    Coordinate ControlChapter 1111-40Programmable zone 3 can define an area which the grinding wheel cannotenter or cannot exit. This is determined by the current wheel locationwhen programmable zone 3 is made active. Generally, you use zones toprotect some vital area of the machine or part located w...

  • Page 357

    Chapter 11Coordinate Control11-41This area is determined by the current wheel location when programmablezone 3 is made active.Figure 11.25Programmable Zone 3This area becomes ProgrammableZone 3 if the zone is enabledwhen wheel is inside of this areaProgrammable Zone 3if enabled when wheelis outsi...

  • Page 358

    Coordinate ControlChapter 1111-42For example, the following block:G22 X10 K2;redefines the maximum X coordinate of programmable zone 3 at a value of10, and the minimum Z coordinate of programmable zone 3 at a value of 2.Any unspecified axis parameters remain at their currently defined value.The c...

  • Page 359

    Chapter 11Coordinate Control11-43The control stops grinding wheel travel during overtravel conditions.Overtravel conditions can occur from 3 causes:hardware overtravel ---- the axes reach a travel limit, usually set by alimit switch or sensor mounted on the axis. Hardware overtravels arealways ac...

  • Page 360

    Coordinate ControlChapter 1111-443.Press the <E-STOP RESET> button to reset the emergency stopcondition. If the E-STOP does not reset, it is a result of some causeother than overtravel causing E-STOP.4.Make sure it is safe to move the axis away from the overtravel limit.5.Use any of the jog...

  • Page 361

    Chapter 11Coordinate Control11-45Example 11.14Absolute vs. Incremental CommandsAbsolute CommandIncremental CommandG90X20.Z10.;G91X10.Z-25.;Figure 11.26Results of Example 11.142010XZStart pointEnd point103512181-IYou can program a G70 to select the inch system or a G71 to select themetric system. ...

  • Page 362

    Coordinate ControlChapter 1111-46Usually workpieces on cylindrical grinders are cylindrical in shape. Thecontrol allows programming of workpiece dimensions as radius ordiameter values. It also allows data to be entered into the offset tables aseither radius or diameter values.This feature is only...

  • Page 363

    Chapter 11Coordinate Control11-47Figure 11.27Results of Example 11.15X10155ZDiameter ProgrammingMode (G08)G90G08X12.Z20;orG91G08X-8Z-5.;6121020Radius ProgrammingMode (G07)G90G07X6Z20;orG91G07X-4.Z-5;51015202512025-IImportant: You must always program the following as radius value,regardless of whe...

  • Page 364

    Coordinate ControlChapter 1111-48This section contains the following subsections:Topic:On Page:Scaling and Axis Position Display Screens11-51Scaling Magnification Data Screen11-52Scaling Restrictions11-54Use the scaling feature to reduce or enlarge a programmed shape. Thisfeature is enabled by pr...

  • Page 365

    Chapter 11Coordinate Control11-49Example 11.16Scaling with Absolute Mode ActiveProgram blockCommentG07 G90 G00 X30. Z60.;radius mode, absolute modeG14.1 X0 P.5;scale X axis only, by .5G01 X12.;feedrate move XZ30.;feedrate move ZX20.;feedrate move XG14;cancel scalingG00 X30. Z60.;rapid returnFigur...

  • Page 366

    Coordinate ControlChapter 1111-50Example 11.17Scaling with Incremental Mode ActiveProgram blockCommentG07 G90 G00 X30. Z60.;radius mode, absolute modeG91;incremental modeG14.1 X1.023 P.5;scale X by .5 (X value is ignored)G01 X-18.;feedrate move XZ-30.;feedrate move ZX8.;feedrate move XG14;cancel ...

  • Page 367

    Chapter 11Coordinate Control11-51The control provides the PAL program with the option of monitoringwhich axes are currently being scaled, on an axis by axis basis, through thePAL flag $SCAX. See the PAL Reference manual (publication 8520-4.2)for additional information.When scaling is enabled for ...

  • Page 368

    Coordinate ControlChapter 1111-52The scaling magnification data screen lists the currently active scalingmagnification amount, the current center of scaling, and the default scalingmagnification amount for all axes. The currently active scalingmagnification amount and the current center of scalin...

  • Page 369

    Chapter 11Coordinate Control11-53The scaling magnification data screen appears:REPLCEVALUESCALING MAGNIFICATIONCENTERCURRENTDEFAULTX+123.000002.000001.00000Z+123.000002.000001.00000Important: If you configure an axis as a rotary axis, the scalingmagnification display screen displays dashes instea...

  • Page 370

    Coordinate ControlChapter 1111-543.Use the up and down cursor keys to move the block cursor to thedefault value you want to change. The selected default value appearsin reverse video.4.To replace stored default scaling magnification value, key-in the newdefault value and press the {REPLCE VALUE} ...

  • Page 371

    Chapter 11Coordinate Control11-55In circular mode, the scale factors for the axes of the active plane haveto be the same. The control generates an error if the scale factors of theaxes are not equalScaling is applied to the following fixed cycles as shown below. Theaxis letters can vary depending...

  • Page 372

    Coordinate ControlChapter 1111-56G33G33 Z_F_E_QG33 X_Z_F_E_QG33 X_F_E_QX (scaled)Z (scaled)E (not scaled)F (not scaled)Q (not scaled)G34G34 Z_F_E_Q KG34 X_Z_F_E_Q KG34 X_F_E_Q KX (scaled)Z (scaled)E (not scaled)F (not scaled)Q (not scaled)K (scaled)G20G20 X_Z_I_X (scaled)Z (scaled)I (scaled)ATTEN...

  • Page 373

    Chapter1212-1Axis MotionThis chapter covers the group of G--codes that generate axis motion ordwell data blocks. The major topics covered include:Topic:On page:Positioning Axes12-1QuickPath Plus12-11Chamfering and Corner Radius12-22Automatic Motion To and From Machine Home12-27Spindle Speed Contr...

  • Page 374

    Axis MotionChapter 1212-2After the execution of a positioning command, the program proceeds to thenext block only after an in-position check function confirms that allcommanded axes have reached their in-position band. Your systeminstaller sets the in-position band width in AMP. See page 12-70 fo...

  • Page 375

    Axis MotionChapter 1212-3Figure 12.1G00 Positioning, Results of Example 12.175ZX3010516012028-IImportant: The control stores all F--words programmed in the positioningmode as the active feedrate in control memory, but the control ignoresthem during positioning mode (G00).The format for linear int...

  • Page 376

    Axis MotionChapter 1212-4Example 12.2Linear InterpolationAbsolute commandIncremental commandG08;G08;G90G01X30.Z60.F.1;G91G01X10.Z-65.F.1;Figure 12.2Results of Linear Interpolation (G01) Example 12.2X6065Z203012029-IOnce you program the feedrate F, it remains effective until you programanother fee...

  • Page 377

    Axis MotionChapter 1212-5G02 and G03 establish the circular interpolation mode. In G02 mode, thegrinding wheel moves along a clockwise arc; in G03 mode, the wheelmoves along a counterclockwise arc. Figure 12.3 shows clockwise andcounterclockwise orientation relative to the positive X and Z axes.F...

  • Page 378

    Axis MotionChapter 1212-6The format for circular interpolation in the ZX plane is as follows:G02X__ Z__I__ K__F__ ;G03R__Where :Is :X, Zin absolute (G90) mode, these are the work coordinate values of the end point.In incremental (G91) mode these are the positions of the end point in referenceto t...

  • Page 379

    Axis MotionChapter 1212-7Figure 12.4Results of Circular Interpolation Example 12.4XZ5015R154520startpoint12030-IWhen programming an arc using the radius (R) value, two arcs are possible(Figure 12.5). Program the R--word with a positive or negative value todistinguish between these arcs.Example 12...

  • Page 380

    Axis MotionChapter 1212-8Figure 12.5Results of An Arc Programmed with Radius Command, Example 12.5R-18startpointArc 1R18end pointArc 2Z4025X12147-IImportant: Any axis that is not specified when programming a circleremains at its current axis position value. This results in the end point ofan arc ...

  • Page 381

    Axis MotionChapter 1212-9Figure 12.6Results of An Arc with End Point Equal to Start Point, Example 12.6Full circle0 degree center angle arc(no axis motion)Arc 251051015101510XZZXendstartCenter definedby I and KstartendCenter definedby R12148-IIf programming a radius command R in the same block as...

  • Page 382

    Axis MotionChapter 1212-10Typically you program a rotary axis in a block by itself or with linearmoves (rapid G00 or linear G01 moves). You can, however, program arotary axis in a block that contains circular moves (G02 or G03).Programming in Absolute or IncrementalYou can program rotary axes in ...

  • Page 383

    Axis MotionChapter 1212-11If circular interpolation mode is active (G02 or G03) you cannot program arotary axis move unless the following conditions are met:the rotary axis cannot be in the active planethe rotary axis must be programmed in the same block as a valid circularmoved made with the axe...

  • Page 384

    Axis MotionChapter 1212-12The control offers a variety of sample patterns with prompting to aid in theprogramming of QuickPath Plus. These are found under the QuickViewfeature described in chapter 5.Remember these points when programming QuickPath Plus:Your system installer may have assigned ,A (...

  • Page 385

    Axis MotionChapter 1212-13If you program an L--word in a G13, or G13.1 block, an error occursThis section describes 3 programming situations in which QuickPath Pluscan be used:Only one end coordinate knownNo end coordinate known (L)No intersection knownOne End Coordinate KnownMany times part draw...

  • Page 386

    Axis MotionChapter 1212-14Example 12.7Angle Programmed:N10 G01 X0.0 Z25.0 F.1.;N20 X15. A90;N30 Z5.A165;Figure 12.7Results of Angle Programmed, Example 12.7XZ510152025151050165°12149-IImportant: Circular QuickPath Plus can also use an angle (A) in aprogram block. This is described on page 12-17....

  • Page 387

    Axis MotionChapter 1212-15current plane, then QuickPath Plus is not performed and the controlignores the A-- and the L--words in the block.Example 12.8Angle and Length Programmed:N10 G01 X0. Z25. F.1.;N20 A90 L15;N30 A165 L20.7;Figure 12.8Results of Angle and Length Programmed, Example 12.8XZ5101...

  • Page 388

    Axis MotionChapter 1212-16The format for these blocks is as follows:N1 A__;N2 A__Z__X__;Where :Is :AAnglethis word, determined in AMP by your system installer, defines theangle of a linear path. This manual assumes that the A--word is used.The angle is a positive value when measured counter-clock...

  • Page 389

    Axis MotionChapter 1212-17Circular QuickPath Plus helps the programmer when a drawing does notcall out the actual intersection of two consecutive paths and at least one ofthe paths is circular. This provides the programmer with the option of nothaving to do any complex calculations to determine e...

  • Page 390

    Axis MotionChapter 1212-18The angle word (A) cannot be programmed in a circular blockThe absolute coordinate values for both axes in the current plane mustbe programmed in the second block. Both must be programmedregardless of whether there is axis motion or notLinear-to-Circular BlocksWhen the c...

  • Page 391

    Axis MotionChapter 1212-19Figure 12.11Results of Line into Arc Without Intersection, Example 12.10XZ135°90°KI2015105510152025R 10.012151-IImportant: R cannot be programmed to specify the arc radius forlinear-to-circular block combinations unless the two paths are tangent.

  • Page 392

    Axis MotionChapter 1212-20Circular-to-Linear BlocksWhen the coordinates of the intersection of a circular path into a linearpath are not known, use the following format. A G13 or G13.1 must beprogrammed in the first of the two blocks and absolute coordinate valuesmust be used.Format:G13G02I__K_;o...

  • Page 393

    Axis MotionChapter 1212-21Circular-to-Circular BlocksWhen the coordinates of the point of intersection of a circular path into acircular path are not known, use the following format. A G13 or G13.1must be programmed. If using this format the R--word cannot be used tospecify the radius of an arc i...

  • Page 394

    Axis MotionChapter 1212-22During cornering, the control can perform a chamfer (a linear transitionbetween blocks) or a corner radius (an arc transition between blocks).,CChamfer sizeThis word defines a chamfer length that connects two inter-secting paths. Its value determines the distance that th...

  • Page 395

    Axis MotionChapter 1212-23ChamferingProgram a ,C--word to grind a chamfer between two consecutiveintersecting paths. The chamfer word C must follow a comma (,) and isprogrammed in the first of two paths to be connected by the chamfer.The value programmed with the ,C determines the chamfer size:if...

  • Page 396

    Axis MotionChapter 1212-24Example 12.14Linear-to-Circular Motions with ChamferN10X0.Z0.F.1;N20X10.Z10.,C5;N30G02X20.Z20.R10;Figure 12.15Results of Linear-to-Circular Motions with Chamfer, Example 12.14Actual start point ofblock N30 and endpoint of chamfer blockProgrammed end pointof block N20Actu...

  • Page 397

    Axis MotionChapter 1212-25Corner RadiusProgram a ,R--word to grind a radius between two consecutive intersectingpaths. The radius word R must follow a comma (,) and is programmed inthe first of two paths to be connected by the radius.The value programmed with the ,R determines the radius size. Re...

  • Page 398

    Axis MotionChapter 1212-26Example 12.16Radius and Chamfer with QuickPath PlusN10Z25.X0.F.1;N20G01A90,C2.;N30Z15.X20.A180,R5.;N40X40.;N50Z5.;Figure 12.17Results of Radius and Chamfer, Example 12.16XZ40.020.02.0R5.010.020.05.012031-IConsiderations with Chamfering and Corner RadiusIf the control is ...

  • Page 399

    Axis MotionChapter 1212-27An error is generated if an attempt is made to change planes betweenblocks that are chamfer or corner radius blocks,C and ,R must be programmed in blocks that contain axis motion in thecurrent plane. If they are programmed in a block that does not containaxis motion in t...

  • Page 400

    Axis MotionChapter 1212-28Automatic homing is accomplished through the use of a G28 code. Whenprogrammed as the first motion block in a part program, (or through MDI)a G28 automatically homes any axes programmed in the G28 block thathave not yet been homed. Only axes that have their axis wordspro...

  • Page 401

    Axis MotionChapter 1212-29When a G28 is executed in a part program (or through MDI) after the axeshave already been homed, it causes a return to machine home. In this case,the axes specified in the G28 block simply go to their respective homeposition in the machine coordinate system after moving ...

  • Page 402

    Axis MotionChapter 1212-30Figure 12.18Automatic Return to Machine Home (G28)ZIntermediate pointMachine home12032-IUsually a G28 is followed by a G29 (automatic return from machinehome) in a part program; however, the control stores the intermediate pointin memory for use with any subsequent G29 b...

  • Page 403

    Axis MotionChapter 1212-31in the G29 block. If a G28 was just executed, this has the effect ofreturning the axis from machine home. For example, executing the block:G29 X7.0 Z1.5;in absolute mode would move the axes to (7.0, 1.5) after passing throughthe intermediate point stored in control memor...

  • Page 404

    Axis MotionChapter 1212-32Figure 12.19Automatic Return From Machine Home, Results of Example 12.17XZ5010015020050100150200N10N20N30N30N40Machine home12157-IImportant: When a G29 is executed, offsets and/or compensation isdeactivated on the way to the intermediate point and are re-activated whenth...

  • Page 405

    Axis MotionChapter 1212-33The G30 command is similar to the G28 command, with the maindifference being that the axis or axes move to an alternate home positioninstead of machine home. The command format determines whether theaxes return to a second, third, or fourth alternate home position. Any a...

  • Page 406

    Axis MotionChapter 1212-34This section covers the following topics:Topic:On page:Surface Grinder, No S--word12-35Surface Grinder, S--word for Wheel Speed12-36Cylindrical Grinder, S--word for Part Speed12-37Cylindrical Grinder, S--word for Wheel Speed12-40Notes on Constant Surface Speed Mode (G96)...

  • Page 407

    Axis MotionChapter 1212-35There are a number of different grinder configurations possible using thecontrol. The constant surface speed mode (G96) and the RPM spindlespeed mode (G97) can be applied to certain grinder configurations undercertain conditions. To adequately deal with the possibilities...

  • Page 408

    Axis MotionChapter 1212-36If your surface grinding machine uses the S--word to control wheel spindlespeed, then CSS (programmed with a G96) and its counterpart RPMspindle speed mode (programmed with a G97) are available.When CSS is active during surface grinding, it maintains the surface speedat ...

  • Page 409

    Axis MotionChapter 1212-37The format for the G96 block is:G96 L__S__;Where :Is :Lspecifies whether CSS is in per minute or per second mode. L1 specifies persecond mode. L0 specifies per minute mode. If L is not programmed the controluses the default mode defined in AMP by your system installer.Ss...

  • Page 410

    Axis MotionChapter 1212-38The format for the G96 block is:G96 L__S__;Where :Is :Lspecifies whether CSS is in per minute or per second mode. L1 specifies persecond mode. L0 specifies per minute mode. If L is not programmed the controluses the default mode defined in AMP by your system installer.Ss...

  • Page 411

    Axis MotionChapter 1212-39Figure 12.21Part Spindle Speed Modified for CSSPart speed (Np)PartPart diameter(Dp)Wheel speed(Nw)Wheel diameter(Dw)Part speed is modified tomaintain constant surfacespeed12034-IUse the following equation to determine part speed in RPM when CSS isactive. This equation is...

  • Page 412

    Axis MotionChapter 1212-40If your cylindrical grinding machine uses the S--word to control wheelspindle speed, then CSS (programmed with a G96) is available whendressing the grinding wheel and when grinding the part. RPM spindlespeed mode (programmed with a G97) is also available for the wheelspi...

  • Page 413

    Axis MotionChapter 1212-41Figure 12.22Wheel Spindle Speed Modified for CSSPart speed (Np)PartPart diameter(Dp)Wheel speed(Nw)Wheel diameter(Dw)Wheel speed ismodified tomaintainconstantsurface speed12035-IGrinding wheel surface speeds relative to the surface of a rotating partshould be based on th...

  • Page 414

    Axis MotionChapter 1212-42The previous sections described the basic function of CSS with differentgrinding machine configurations. This section includes some specificconsiderations for CSS operation.Enabling (M58) and Disabling (M59) CSS ModeThe G96 mode must first be enabled by programming an M5...

  • Page 415

    Axis MotionChapter 1212-43Example 12.18Initiating G96 mode with no S- wordProgramCommentsG97 S5000;RPM spindle speed mode, 5,000 rpmX25. Z5.;X diameter move to 25, Z move to 5X20.;X move to 20, spindle remains at 5,000 rpmG96;CSS mode, no S--word, spindle remains at 5,000 rpmX15.;X move to 15, sp...

  • Page 416

    Axis MotionChapter 1212-44Spindle Speed during Rapid TraverseDuring rapid moves while in G96 mode, spindle speed changes in one ofthe following ways:the spindle speed changes constantly as the relative position of the CSSaxis is changedorthe control calculates the total change in spindle speed (i...

  • Page 417

    Axis MotionChapter 1212-45CSS axis selection depends on what type of machine you have, the axisconfiguration for that machine and the specific grinding application.Surface grinding -- the spindle is typically selected as the CSS axis.This results in CSS calculations being based on the distance fr...

  • Page 418

    Axis MotionChapter 1212-46This section provides examples using CSS in typical surface andcylindrical grinding applications. Before programming any of theseexamples, verify that the conditions listed apply to your machine.CSS While Grinding Part (surface grinding application)Example 12.19 shows ho...

  • Page 419

    Axis MotionChapter 1212-47Figure 12.23Results of Example 12.19, CSS while Surface Grinding500321Grindingwheel300--Z--Y12105-I400PartGrinding Wheel PositionWheel Diameter afterdressing (mm)Wheel Spindle Speed (rpm)15005,73024007,16233009,549CSS While Dressing Wheel (surface/cylindrical grinding ap...

  • Page 420

    Axis MotionChapter 1212-48Example 12.20CSS while Dressing a Grinding WheelProgramCommentsG92 S9000;limit spindle speed to 9,000 rpm maximumG90M58;activate absolute prog. mode, enable CSSG96 L0 S10000;CSS mode, surface speed of 10,000 m/minG00 X260. Z165.;rapid move to position wheel near dressing...

  • Page 421

    Axis MotionChapter 1212-49CSS While Grinding Part (cylindrical grinding application)Example 12.21 applies strictly to a cylindrical grinder. It shows how thepart spindle speed changes as the diameter of the part being groundchanges. The following conditions are assumed for this example:the S--wor...

  • Page 422

    Axis MotionChapter 1212-50Figure 12.25Results of Example 12.21, CSS while Grinding a Rotating Part200100321GrindingwheelGrindingwheelGrindingwheelPartStartX220, Z70--Z--X12037-IGrinding Wheel PositionPart Diameter (mm)Part Spindle Speed (rpm)12001,27321002,546303,500 11 The calculated spindle spe...

  • Page 423

    Axis MotionChapter 1212-51In the G97 mode, the spindle revolves at the programmed RPM regardlessof the position of the grinding wheel.For example, to revolve the spindle at 500 rpm, program:G97 S500;Important: In most cases, spindle motion is started and stopped byexecuting an M code (typically M...

  • Page 424

    Axis MotionChapter 1212-52Closed loop orient - The part or wheel must be equipped with afeedback device. The final destination of the part or wheel whenperforming a closed loop orient can be determined in AMP, or entered ina program block requesting an orient. When the closed loop orient isperfor...

  • Page 425

    Axis MotionChapter 1212-53This section covers the following topics:Topic:On page:Feedrates Applied During Dresser/Wheel Radius Compensation12-54Feed Per Minute Mode (G94)12-56Feed Per Revolution Mode (G95)12-56Rapid Feedrate12-57Feedrate Overrides12-58Feedrate Limits (Clamp)12-59Rotary Axis Feedr...

  • Page 426

    Axis MotionChapter 1212-54Figure 12.26Programmed Feedrate Executed along the Effective Axis PathZZXXLinear interpolationCircular interpolationprogrammedfeedrateX-axisfeedratestartpointZ-axisfeedrateendpointprogrammedfeedrateend pointX-axisfeedratestartpointZ-axisfeedrate12158-IFor example, if a f...

  • Page 427

    Axis MotionChapter 1212-55For outside arc paths, the speed of the wheel surface relative to the partsurface can be determined using the following formula:RpWheel surface speed=Fx----RcWhere :Is :Fprogrammed feedrateRcradius of the arc measured to the center of the wheel radiusRpprogrammed radius ...

  • Page 428

    Axis MotionChapter 1212-56In the G94 mode (feed per minute), the numeric value following address Frepresents the distance the axis or axes move (in inches or millimeters) perminute. If the axis is a rotary axis, the F--word value represents thenumber of degrees the axis rotates per minute.To prog...

  • Page 429

    Axis MotionChapter 1212-57Figure 12.29Feed Per Revolution Mode (G95)F“F” is the distance thewheel moves per revolutionof the workpieceGrindingwheelBAIf G95 F.2 is the feedrate, thewheel moves from A to Bin 100 revolutions of the workpieceWorkpieceWorkpiece20.0GrindingwheelGrindingwheelGrindin...

  • Page 430

    Axis MotionChapter 1212-58<FEEDRATE OVERRIDE> SwitchThe <FEEDRATE OVERRIDE> switch on the MTB panel can override:the feedrate programmed with an F--word in any of the feedrate modes(G93/94/95)the reciprocation feedrate programmed with an E--word during any ofthe surface or cylindrical...

  • Page 431

    Axis MotionChapter 1212-59Feedrate Override Switches DisableAn M49 causes the override amounts that are set by the switches on theMTB panel to be ignored by the control. With M49 active, the overrideswitches for feedrate, rapid feedrate, and spindle speed are all set to 100%.They can be enabled b...

  • Page 432

    Axis MotionChapter 1212-60The feedrate for a rotary axis is determined in much the same way as for alinear axis.When programming in G94 feed per minute mode, the rotary axis rotatesthe programmed number of degrees at the programmed feedrate. Rotaryfeedrate units are in degrees per minute.When pro...

  • Page 433

    Axis MotionChapter 1212-61This section covers the following topics:Topic:On page:Single-Digit F--words12-61External Deceleration Feedrate Switch12-62You can select special feedrates that are assigned in AMP. The feedrate forrapid moves described on page 12-62 is such a feedrate as is the feedrate...

  • Page 434

    Axis MotionChapter 1212-62Your system installer can install an optional external deceleration switch ifdesired. Typically this is a mechanical switch mounted on the machineaxes inside the hardware overtravel switches (refer to documentationprepared by your system installer for details on the appl...

  • Page 435

    Axis MotionChapter 1212-63This section covers these topics:Topic:On page:Exponential Acc/Dec12-64Linear Acc/Dec12-65Precautions on Corner Grinding12-69Spindle Acceleration (Ramp)12-71Controlling Spindles (G12.1, G12.2, G12.3)12-71Spindle Orientation (M19, M19.2, M19.3)12-72Spindle Direction (M03,...

  • Page 436

    Axis MotionChapter 1212-64Table 12.AAcc/Dec Type Performed with Manual Motion and Programmed MovesMotion TypeAlways Uses ExponentialAcc/DecConfigurable in AMP bySystem Installer viaManual Acc/Dec ModeAlways Uses LinearAcc/DecLinear or S- CurveAcc/Dec per G- codeHand--pulse generatorArbitrary angl...

  • Page 437

    Axis MotionChapter 1212-65Axis motion response lag can be minimized by using Linear Acc/Dec forthe commanded feedrates. Your system installer sets Linear Acc/Decvalues for interpolation for each axis in AMP. Figure 12.32 shows axismotion using Linear Acc/Dec.Figure 12.32Linear Acc/DecTimeTimeAcce...

  • Page 438

    Axis MotionChapter 1212-66When S--Curve Acc/Dec is enabled, the control changes the velocityprofile to have an S--Curve shape during acceleration and decelerationwhen in Positioning or Exact Stop mode. This feature reduces themachine’s axis shock and vibration for the commanded feedrates.Figure...

  • Page 439

    Axis MotionChapter 1212-67Programmable Acc/Dec allows you to change the Linear Acc/Dec modesand values within an active part program via G47.x and G48.x codes.You cannot retrace through programmable acc/dec blocks (G47.x andG48.x). However, you can retrace through blocks where programmableacc/dec...

  • Page 440

    Axis MotionChapter 1212-68Selecting Linear Acc/Dec Values (G48.n - - nonmodal)Programming a G48.x in your part program allows you to switch LinearAcc/Dec values in nonmotion blocks. Axis values in G48.n blocks willalways be treated as absolute, even if the control is in incremental mode.Below is ...

  • Page 441

    Axis MotionChapter 1212-69When exponential acc/dec is active, the control automatically performsacc/dec to give a smooth acceleration/deceleration for grinding wheelmotion. However, there are cases in which exponential acc/dec can resultin rounded corners on a part during grinding.As illustrated ...

  • Page 442

    Axis MotionChapter 1212-70Cutting Mode (G64 - - modal)G64 establishes the cutting mode. This is the normal mode for axis motionand generally is selected by your system installer as the default modeactive on power-up. When active, motion commands begin as soon as themotion command of the previous ...

  • Page 443

    Axis MotionChapter 1212-71corner override distance (DFC) -- vector distance from end of currentmove (b) to point on programmed path (c) where corner override isdeactivatedcorner override percent -- amount that feedrate is to be reduced oncecorner override is activatedTo use an exact stop function...

  • Page 444

    Axis MotionChapter 1212-72For systems with no spindle configured, simulated spindle feedback isprovided for the primary spindle. This allows all control features thatrequire spindle feedback, i.e., IPR feedrate, threading, CSS, to simulate thefeedback from a spindle even through the AMPed system ...

  • Page 445

    Axis MotionChapter 1212-73Important: In systems allowing multiple spindles (9/260 and 9/290), onlyone M19 code can be in a block. If two or more M19 codes appear in oneblock, e.g., M19.2 M19#, this error message appears, “ONLY ONE M19ALLOWED PER BLOCK.”Refer to your system installer’s docum...

  • Page 446

    Axis MotionChapter 1212-74Use the spindle directional M-codes to program each configured spindleprogram controlled spindle rotation.Table 12.D lists the spindle direction codes.Table 12.DSpindle Directional CodesSpindle TypeDirectional CodeThis means:Spindle 1M03M04M05Spindle 1 clockwiseSpindle 1...

  • Page 447

    Axis MotionChapter 1212-75In the control’s default mode (G36), the Acc/Dec feature sometimes limitsaxis feedrates far below the programmed feedrate. This occurs when thelength of axis motion in a block is short relative to the length of timenecessary to accelerate and decelerate the axis.In the...

  • Page 448

    Axis MotionChapter 1212-76To avoid this feedrate limitation, the short block Acc/Dec clamp can bedisabled by programming a G36.1. In this mode, the control assumes thatno rapid decelerations are required and allows axis velocities to go higherthan they otherwise would. Activate G36.1 mode only wh...

  • Page 449

    Axis MotionChapter 1212-77G36 and G36.1 are modal. The control should only be in short blockcheck disable mode (G36.1) when executing a series of fast short blocksthat contain only slight changes in direction and velocity. What constitutesa slight change in direction and velocity is dependent on ...

  • Page 450

    Axis MotionChapter 1212-78This section covers the following topics:Topic:On page:Dwell - Seconds12-78Dwell - Number of Spindle Revolutions12-78The G04 command delays the execution of the next data block. Dwellperiod is specified in either of two types.• Seconds• Number of spindle revolutionsT...

  • Page 451

    Axis MotionChapter 1212-79There are two types of mirroring:programmable mirror imageThis is activated through programming a G50.1 and G51.1manual mirror imageThis is activated through PAL or the {FRONT PANEL} softkeyProgrammable Mirror Image (G50.1, G51.1)Use the programmable mirror image feature...

  • Page 452

    Axis MotionChapter 1212-80Example 12.24Programmable Mirror ImageMain ProgramComment(Mirror);comment block, main programG00G90;rapid positioning, absolute modeM98P8500;call subprogram 8500G51.1Z75.;mirror activeonZM98P8500;call subprogram 8500G51.1X75.;mirror activeonX (and Z)M98P8500;call subprog...

  • Page 453

    Axis MotionChapter 1212-81When the mirror image function is active on only one of a pair of axes, thecontrol:executes a reverse of programmed G02/G03 arcs. G02 becomescounter-clockwise and G03 becomes clockwise.activates a reverse of programmed G41/G42 compensation. G41becomes compensation right ...

  • Page 454

    Axis MotionChapter 1212-82This feature disables the axis position display and lets an axis be clampedinto position. Typically an axis clamp is performed by the execution of anM code in a part program or by a switch of some type controlled by theoperator. Your system installer determines how the a...

  • Page 455

    Axis MotionChapter 1212-83Figure 12.41Dual Axis ConfigurationAxis 1Lead screwServomotorAxis 2Lead screwServomotorEncoderDual Axes - two completely separate axesresponding to the same programmingcommands.Encoder12043-IThe control can support two dual axis groups. A dual axis group consistsof two o...

  • Page 456

    Axis MotionChapter 1212-84Figure 12.42 shows the position display for a system that contains a dualaxis group containing two axes with a master axis name of X. Whether ornot all axes of a dual group show up on the position display is determinedin PAL by your system installer.Important: A dual axi...

  • Page 457

    Axis MotionChapter 1212-85Axes in the dual group can only be parked or unparked when the control is incycle stop and end-of-block state. Also the control cannot be in the processof completing any jog request or PAL axis mover request. If an attempt ismade to park/unpark an axis, and if any one of...

  • Page 458

    Axis MotionChapter 1212-86Homing Axes IndividuallyThis method requires that each axis be homed individually. When amanual home operation is performed, a home request must be made toeach axis in the dual group on an individual method. Refer to chapter 4 fordetails on how to request a manual home o...

  • Page 459

    Axis MotionChapter 1212-87Special consideration must be given when programming these features:Feature:Consideration:Mirror ImagingProgrammable mirror image is applied to all axes in the dual group. Manualmirror image, however, can be applied to each axis in the dual group individually.When manual...

  • Page 460

    Axis MotionChapter 1212-88Consideration should be given to offsets used for a dual axis. In mostcases, each axis can have independent offset values assigned to it. Thissection describes the difference in operation of a dual axis when itconcerns offsets. How to activate/deactivate and enter these ...

  • Page 461

    Axis MotionChapter 1212-89Set ZeroYou can perform a set zero operation on the axes in a dual group on anindividual basis. For example, if you have a dual axis named X and itconsists of two axes, X1 and X2, when the set zero operation is executedthrough PAL, you must specify which axis in the dual...

  • Page 462

    Axis MotionChapter 1212-90

  • Page 463

    Chapter1313-1Wheel Length OffsetsThis chapter describes how to select and activate wheel length offsets.Some grinding applications require the use of wheel length offsets inconjunction with dresser/wheel radius compensation. For details onselecting and activating dresser/wheel radius compensation...

  • Page 464

    Tool Control FunctionsChapter 1313-2The control can store up to 32 wheel length offsets for each axis. Yoursystem installer configures the actual number of available offsets on yoursystem in AMP. Each offset can select a different control point on thewheel. Typically, each time you dress a differ...

  • Page 465

    Tool Control FunctionsChapter 1313-3Your system installer can also write PAL to automatically select andactivate a wheel length and radius/orientation offset number. See yoursystem installer’s documentation and the PAL reference manual for details.Table 13.AT Words and Resulting OffsetsProgram ...

  • Page 466

    Tool Control FunctionsChapter 1313-4Your system installer has the option in AMP to determine exactly whenwheel length offsets take effect and when the wheel position updates on thescreen to the new shifted location. This manual assumes that your systemis configured to immediately shift the coordi...

  • Page 467

    Tool Control FunctionsChapter 1313-5You can enter data in the wheel geometry table and radius/orientationoffset table through programming. This section describes the use of theG10 command for loading these offset tables.Important: Only the value in the table changes when a G10 modifies atable val...

  • Page 468

    Tool Control FunctionsChapter 1313-6Example 13.1Using G10 to Change Offset Table ValuesG90;Selects absolute mode causes values in G10L10 block toreplace existing table values.G10 L10 P01 Z2.1 X3.0 R.3 Q1 O1;Wheel geometry offset number 1 has a new length value of 2.1for Z-axis, 3.0 for X-axis. Ra...

  • Page 469

    Chapter1414-1Angled-Wheel GrindingThis chapter covers angled wheel grinder applications. The followingtopics on angled-wheel grinding are covered in this chapter:Determining the wheel-angle on an angled-wheel grinderSelecting an Angled-Wheel mode (G16.3, G16.4 or G15)Position Displays on an Angle...

  • Page 470

    Angled-Wheel GrindingChapter 1414-2Figure 14.1Angled-Wheel Grinder typical Axis Configuration+X Axis(virtual)+Z AxisPart+WWheel AxisPart SpindleAngled-wheel grinders have the same integrand letter for the wheel axis(W) and the virtual axis (X). Refer to your system installersdocumentation to dete...

  • Page 471

    Angled-Wheel GrindingChapter 1414-3You can home a rotary axis that determines the wheel axis angle while inone of the angled wheel modes. This homing results in angled wheel modebeing re-initialized using the angle of the wheel immediatly after it hasbeen homed.Manually Measuring your Wheel Axis ...

  • Page 472

    Angled-Wheel GrindingChapter 1414-4Programming a part contour (or any wheel path) relative to the part on anangled-wheel grinder while not in one of the angled-wheel grinding modesis difficult. Because of the angle of the grinding wheel, the partprogrammer must consider that any W axis motion gen...

  • Page 473

    Angled-Wheel GrindingChapter 1414-5The angle of the wheel axis should already have been established beforeattempting to enter angled wheel mode. You can not change the value ofthe angled wheel axis in angled wheel mode. Any rotary axis or PALinterface that determines the wheel axis angle must be ...

  • Page 474

    Angled-Wheel GrindingChapter 1414-6Programming RestrictionsWith the exception of G86, G86.1, G87, G87.1, G88, G88.1, G89 andG89.1, the following operations should be performed only in G16.3 mode:- circular interpolation- cylindrical grinding cycles- threading operations- turning cycles- reciproca...

  • Page 475

    Angled-Wheel GrindingChapter 1414-7Figure 14.4Feedrate Clamp Reached on W AxisXAxisFeedrateZ Axis FeedrateWWheel AxisFeedrateThe X axis feedrate is the vectored sum of the W and Z axis feedrates.Note the physical W axis feedrate must always exceed the X axisfeedrate (except for wheel angles of 0 ...

  • Page 476

    Angled-Wheel GrindingChapter 1414-8Upon entry into one of the angled wheel modes the control cancels allactive offsets. Offsets are not canceled when you change between G16.3and G16.4 mode as long as angled wheel mode is not canceled with a G15between modes.Example 14.1Linear Interpolation in G16...

  • Page 477

    Angled-Wheel GrindingChapter 1414-9Two step angled-wheel grinding mode (G16.4) positions the X and Z axesseparately. The control will calculate how much W axis motion mustoccur to reach the programmed X and Z endpoint. Z and W axis movesare positioned to their respective endpoints in two independ...

  • Page 478

    Angled-Wheel GrindingChapter 1414-10Example 14.2Linear Interpolation in G16.4 Two Step Angled-Wheel Grinding Mode(motionisawayfrom part)This example assumes a 60° wheel axis angle.G15;G08G90 G00W0Z0;G16.4;G90G01X20Z10F.1;10102020+Z+X+WIn this example, the W axis is positioned a positive 40 inche...

  • Page 479

    Angled-Wheel GrindingChapter 1414-11The W axis must be homed before any programmed motion can occur onthe X axis. If a rotary axis is used to determine the angle of the wheel axis,that rotary axis must also be homed before positioning on the X axis canoccur.Acceleration/Deceleration Consideration...

  • Page 480

    Angled-Wheel GrindingChapter 1414-12This section covers how axis position registers are presented on theoperator panel. Some screens will show a combination of the followingaxis position registers:Z (real) -- This is the physical position of the grinding wheel along the Zaxis slide relative to a ...

  • Page 481

    Angled-Wheel GrindingChapter 1414-13The following table shows the position displays as a program executesunder the following conditions:in G16.3 normal angled wheel modein single block mode.wheel axis angle of 60 degreesProgram Block:Program Display:Absolute Display:Program Block:WZXWZXG07G00W0Z0...

  • Page 482

    Angled-Wheel GrindingChapter 1414-14This section covers features or considerations that must be taken intoaccount when jogging an angled-wheel grinder. For details on using thejogging features refer to the manual motion sections starting on page 4-1.All manual motions use normal angled-wheel posi...

  • Page 483

    Angled-Wheel GrindingChapter 1414-15Multiple axis jogs or arbitrary angle jogs are permitted with axes otherthan X, Z, and W. For example a UZ or UX jog would be possibleassuming U was an axis not in the angled-wheel plane and not theangled-wheel rotary axis.While not in angled-wheel mode (G15 ac...

  • Page 484

    Angled-Wheel GrindingChapter 1414-16When angled-wheel mode is exited either:the plane that was active prior to entering angled-wheel mode isre-establishedorif a plane select G code is programmed in the G15 block, that planebecomes active.Read this section if you are using wheel length and radius ...

  • Page 485

    Angled-Wheel GrindingChapter 1414-17Wheel Length OffsetsWhen wheel length offsets are entered into the offset table both theX(virtual) and W(real) axes allow entry. When a wheel length offset isactivated the control selects the offset value out of the offset table asfollows:in Angled-Wheel Mode:(...

  • Page 486

    Angled-Wheel GrindingChapter 1414-18Programmable ZonesFor details on what programmable zones are and how they work refer topage 11-34. Programmable zones can be configured by the systeminstaller, programmer, or operator. The programmable zones you set up onan angled wheel grinder are significantl...

  • Page 487

    Angled-Wheel GrindingChapter 1414-19When you make the transition into angled-wheel mode, zone valuesentered for the W axis are transformed over to the X axis based on yourcurrent wheel axis angle. The equation used to transform values from theW tothe X axisisasfollows:X zone value = (COS A)(W zon...

  • Page 488

    Angled-Wheel GrindingChapter 1414-20If you last entered W axis values, those values are transformed over to theX axis for angled wheel mode. If you last entered X axis values thosevalues are transformed over to the W axis for non-angled wheel mode.ATTENTION: Changing the wheel axis angle results ...

  • Page 489

    Chapter1515-1Dresser/Wheel Radius CompensationThis chapter contains this information:Topic:On page:Introduction to Dresser/Wheel Radius Compensation15-2Programming Compensation (G40, G41, G42)15-5Application Schemes15-5Compensation Block Format15-12Generated Compensation Blocks G39, G39.115-15Typ...

  • Page 490

    workpiece/wheelInside angle(less than 180°)Outside angle(greater than 180°)workpiece/wheelDresser/Wheel Radius CompensationChapter 1515-2Terms UsedWe use the following terms in this chapter:If you see:It means:insidean angle between two intersecting programmed paths is referred to as inside if,...

  • Page 491

    Dresser/Wheel Radius CompensationChapter 1515-3Dresser/wheel radius compensation also uses dresser/wheel orientationdata. You need orientation data:to compensate for inaccuracies that can occur from difficulties inmeasuring wheel corner and dresser radius because of mountingpositionandto tell the...

  • Page 492

    Dresser/Wheel Radius CompensationChapter 1515-4Figure 15.1Grinding Wheel Radius Compensation Taper and Arc CuttingMaterial left uncutdue to radiuswheel cornerWithout dresser/wheel radiuscompensation active, control assumesgrinding wheel has a sharp cornerdressedProgrammedPart ProfileX length offs...

  • Page 493

    Dresser/Wheel Radius CompensationChapter 1515-5Use the G-codes in Table 15.A for dresser/wheel radius compensation:Table 15.AG Code Compensation DirectionG Code 1:Dresser/Wheel Radius Compensation:G40cancelG41left of program path 2G42right of program path 21All of these G-codes are modal and belo...

  • Page 494

    Dresser/Wheel Radius CompensationChapter 1515-6We describe these 3 compensation schemes below:Dresser/wheel RadiusCompensation SchemeLength OffsetsCoordinate SystemOffset (G54-G59.3)Dresser/wheel RadiusCompensationDresser RadiusShifted on Z and X axis to wheelcontrol pointShifted to point ondress...

  • Page 495

    Dresser/Wheel Radius CompensationChapter 1515-7Dresser RadiusThe control can compensate for any dressing error resulting from slight oreven large radius of the dresser tip. To do so, you must enter the radius ofthe dresser in the radius table for radius compensation to properlycompensate.Figure 1...

  • Page 496

    Dresser/Wheel Radius CompensationChapter 1515-8Figure 15.5Diamond Dresser Relative Motion Across Grinding Wheel to EstablishCompensation DirectionG41;Compensation left(radius is left ofprogrammed path)G41; CompensationleftG42; CompensationrightG42;Compensation right(radiusisrightofprogrammed path...

  • Page 497

    Dresser/Wheel Radius CompensationChapter 1515-9Figure 15.6Corner Radius for a Typical Grinding WheelX length offsetZlengthoffsetX length offsetZlengthoffset.25Radius.3Radius12086-ISee Table 15.A for compensation direction for G codes.Figure 15.7Grinding Wheel Motion Across Part to Establish Compe...

  • Page 498

    Dresser/Wheel Radius CompensationChapter 1515-10Use care when programming contours using this compensation scheme.You must consider the wheel width when programming and change to theproper control point using the appropriate wheel length offsets as thecontour of the part dictates.Figure 15.8Progr...

  • Page 499

    Dresser/Wheel Radius CompensationChapter 1515-11Entire Wheel RadiusThe control can compensate for any grinding error resulting from theradius of the entire grinding wheel. To do so, you must enter the radius ofthe wheel in the radius table for radius compensation to properlycompensate. This metho...

  • Page 500

    Dresser/Wheel Radius CompensationChapter 1515-12Figure 15.11Grinding Wheel Motion Across Part to Establish Compensation DirectionIf controlling this cornerG42;CompensationrightG41;CompensationleftTypical Surface Grinder Radius Compensation12091-IProgram the dresser/wheel radius compensation funct...

  • Page 501

    Dresser/Wheel Radius CompensationChapter 1515-13You can activate dresser/wheel radius compensation in various ways.Example 15.1 illustrates a few examples of activating dresser/wheel radiuscompensation.Example 15.1Initializing Dresser/Wheel Radius CompensationAssume: G18 (ZX Plane Selection)Progr...

  • Page 502

    Dresser/Wheel Radius CompensationChapter 1515-14For details on programming a T word, see page 10-36. If you program a Tword that contains a change in dresser/wheel radius after dresser/wheelradius compensation is activated, the next block that contains axis motionin the current plane must be a li...

  • Page 503

    Dresser/Wheel Radius CompensationChapter 1515-15Figure 15.12Results of Dresser/Wheel Radius Compensation Program ExampleRelative Dresser center path (oppositeactual wheel path)XZN1N2N3N4N5N6Grinding Wheel0Wheelcontrolpoint12092-IIn certain instances, dresser/wheel radius compensation creates anon...

  • Page 504

    Dresser/Wheel Radius CompensationChapter 1515-16You can program the generated block between the two dresser/wheel pathsas linear or circular with these G-codes:G39(or G39.1);Where :Causes:G39linear transition blocks. If you program a G39 or G39.1, G39 is thedefault (established at control reset o...

  • Page 505

    Dresser/Wheel Radius CompensationChapter 1515-17We use pictorial representation to demonstrate the actual dresser/wheelpaths taken when using dresser/wheel radius compensation type A. Thefollowing subsections give brief descriptions of the paths along withfigures to clarify the descriptions.We de...

  • Page 506

    Dresser/Wheel Radius CompensationChapter 1515-18Figure 15.15 and Figure 15.16 show examples of typical entry moves usingtype A radius compensation.Figure 15.15Dresser/Wheel Path for Entry Move Straight Line-to-Straight Line0≤θ≤ 9090≤θ≤ 180270≤θ≤ 360180≤θ≤ 270G41ProgrammedpathG...

  • Page 507

    Dresser/Wheel Radius CompensationChapter 1515-19If the move following the entry move is an arc, the dresser/wheel ispositioned at right angles to a tangent line drawn from the start-point ofthat circular move.Figure 15.16Dresser/Wheel Path for Entry Move Straight Line-to-Arc0≤θ ≤ 9090≤θ ...

  • Page 508

    Dresser/Wheel Radius CompensationChapter 1515-20Example 15.3Sample Entry Move After Non-Motion BlocksAssume current compensation plane is the ZX plane.N01X0Z0;N2G41T1;This block commands compensation leftN3M02;This is not the entry block since no axis motion takes place inthe current plane.N4...;...

  • Page 509

    Dresser/Wheel Radius CompensationChapter 1515-21Example 15.4Type A Sample Exit MovesAssume the current plane is the ZX plane and dresser/wheel radiuscompensation is already active before the execution of block N100 in thefollowing program segments.N100X1.Z1.;N110X3.Z3.G40;Exit move.N100X1.Z1.;N11...

  • Page 510

    Dresser/Wheel Radius CompensationChapter 1515-22Figure 15.17 through Figure 15.21 show examples of typical exit movesusing type A radius compensation. All examples assume that the numberof non-motion blocks before the G40 command has not exceeded thenumber allowed, as determined by your system in...

  • Page 511

    Dresser/Wheel Radius CompensationChapter 1515-23If the last programmed move is circular (an arc), the dresser/wheel ispositioned at a right angle to a tangent line drawn from the end-point ofthat circular move.Figure 15.18Dresser/Wheel Path for Exit Move Arc-to-Straight Line0≤θ ≤ 90θProgram...

  • Page 512

    Dresser/Wheel Radius CompensationChapter 1515-24I and K Vector in an Exit MoveBy including an I and/or K word in the exit move, you can modify the paththat the dresser/wheel takes for an exit move. Only the I or K words thatrepresent values in the current plane are programmed in the blockcontaini...

  • Page 513

    Dresser/Wheel Radius CompensationChapter 1515-25There is a limit to the amount that an I, K vector can modify the lastcompensated block. An I, K vector can only shorten/lengthen the lastcompensated block by an amount equal to one active dresser/wheel radius(see Example 15.5). The direction of the...

  • Page 514

    Dresser/Wheel Radius CompensationChapter 1515-26If the vector defined by I and/or K is parallel to the programmeddresser/wheel path, the resulting exit move is offset in the oppositedirection of the I and/or K vector by one radius of the dresser/wheel.See Figure 15.21.Figure 15.21Exit Move When I...

  • Page 515

    Dresser/Wheel Radius CompensationChapter 1515-27We use pictorial representation to demonstrate the actual dresser/wheelpaths taken by the dresser/wheel when using radius compensation type B.The following subsections give brief descriptions of the paths along withfigures.We define an entry move as...

  • Page 516

    Dresser/Wheel Radius CompensationChapter 1515-28Figure 15.23 and Figure 15.24 show examples of typical entry moves usingtype B radius compensation.Figure 15.23Dresser/Wheel Path for Entry Move Straight Line-to-Straight Line0≤θ≤ 9090≤θ≤ 180180≤θ≤ 270270≤θ≤ 360EG41G42Programmedp...

  • Page 517

    Dresser/Wheel Radius CompensationChapter 1515-29If the next programmed move is circular (an arc), the dresser/wheel ispositioned at right angles to a tangent line drawn from the start-point ofthat circular move.Figure 15.24Dresser/Wheel Path for Entry Move Straight Line-to-Arc0≤θ ≤ 9090≤θ...

  • Page 518

    Dresser/Wheel Radius CompensationChapter 1515-30There is no limit to the number of blocks that can follow the programmingof G41 or G42 before an entry move takes place. The entry move isalways the same regardless of the number of blocks that do not programmotion in the current plane for compensat...

  • Page 519

    Dresser/Wheel Radius CompensationChapter 1515-31Selecting a dresser/wheel offset number T0000 in a program does notcancel radius compensation and does not generate an exit move. Radiuscompensation continues on as if a dresser/wheel radius had been changedto a radius of zero. See page 15-51 on cha...

  • Page 520

    Dresser/Wheel Radius CompensationChapter 1515-32If the number of non-motion blocks in the compensation mode has notexceeded a value selected by your system installer in AMP, all of theprogram blocks in Example 15.7 produce the same exit move.The exit of the dresser/wheel for type B radius compens...

  • Page 521

    Dresser/Wheel Radius CompensationChapter 1515-33Figure 15.25Dresser/Wheel Path for Exit Move Straight Line-to-Straight Line0≤θ≤ 9090≤θ≤ 180180≤θ≤ 270270≤θ≤ 360AProgrammedpathG41G42ProgrammedpathG41G42ProgrammedpathG41G42ProgrammedpathG41G42θθθθAABCDEEnd-pointCBABCEnd-point...

  • Page 522

    Dresser/Wheel Radius CompensationChapter 1515-34If the last programmed move is circular (an arc), the dresser/wheel ispositioned at a right angle to a tangent line drawn from the end-point ofthat circular move.Figure 15.26Dresser/Wheel Path for Exit Move Arc-to-Straight LineθθθθEnd-pointEnd-p...

  • Page 523

    Dresser/Wheel Radius CompensationChapter 1515-35Figure 15.25 and Figure 15.26 assume that the number of blocks notcontaining axes motion in the currently selected plane, following G40before the exit move takes place, does not exceed an amount selected inAMP by your system installer. If the number...

  • Page 524

    Dresser/Wheel Radius CompensationChapter 1515-36There is a limit to the size that an I, K vector can modify the lastcompensated block. An I, K vector can only shorten/lengthen the lastcompensated block by an amount equal to one active dresser/wheel radius(see Example 15.8). The offsets are direct...

  • Page 525

    Dresser/Wheel Radius CompensationChapter 1515-37If the vector defined by I and/or K is parallel to the programmeddresser/wheel path, the resulting exit move is offset in the oppositedirection of the I and/or K vector by one radius of the dresser/wheel (seeFigure 15.29).Figure 15.29Exit Move When ...

  • Page 526

    Dresser/Wheel Radius CompensationChapter 1515-38When necessary, the control generates extra motion blocks to keep thedresser/wheel in tolerance of the desired path. This becomes necessarywhen the intersection of paths is an outside path (as defined on page 15-2)that has an angle as follows:Betwee...

  • Page 527

    Dresser/Wheel Radius CompensationChapter 1515-39Figure 15.31Dresser/Wheel Radius Compensation paths Straight Line-to-Arc0≤θ≤ 90generatedblocksProgrammedpathG41G42270≤θ≤ 360θrrr0≤θ≤ 90ProgrammedpathG41G42θr270≤θ≤ 360ProgrammedpathG42G41rG39.1 (Circular Generated Block)G39 (Li...

  • Page 528

    Dresser/Wheel Radius CompensationChapter 1515-40Figure 15.32Dresser/Wheel Radius Compensation paths Arc-to-Straight Line0≤θ≤ 90ProgrammedpathθLineargeneratedblocksrrrG41G420≤θ≤ 90ProgrammedpathθrG41G42G39.1 (Circular Generated Block)G39 (Linear Generated Blocks)G39.1 (Circular Generat...

  • Page 529

    Dresser/Wheel Radius CompensationChapter 1515-41Figure 15.33Dresser/Wheel Radius Compensation paths Arc-to-Arc90≤θ≤ 180180≤θ≤ 270270≤θ≤ 360ProgrammedpathProgrammedpathG41G41G42G42G42Programmedpathθθθrr270≤θ≤ 360G42Programmedpathθr0≤θ≤ 90G41G42ProgrammedpathθrrrrrG39....

  • Page 530

    Dresser/Wheel Radius CompensationChapter 1515-42The following subsections cover possible paths that can be generated whenprogramming one of these during radius compensation:Changing radius compensation direction (cross-over dresser/wheelpaths)Exceeding the allowable number of consecutive, non-mot...

  • Page 531

    Dresser/Wheel Radius CompensationChapter 1515-43The control generates the motion block that connects point 1 to point 2 asshown in the examples below:Example 15.9Linear-to-Linear Change in Dresser/Wheel Radius CompensationDirection (Reversing Path)N10 Z10.G41;N11 Z20.;N12 Z10.G42;N13 Z0.;Figure 1...

  • Page 532

    Dresser/Wheel Radius CompensationChapter 1515-44Example 15.11Linear-to-Linear Change in Dresser/Wheel Radius CompensationDirection (With Generated Blocks)N10 X15.Z10.G41;N11 X-5.Z8.;N12 X0.Z35.G42;Figure 15.36Results of Example 15.11CompensatedpathProgrammedpathPoint 2Point 1G42N12N11N10G41rrrrrr...

  • Page 533

    Dresser/Wheel Radius CompensationChapter 1515-45For one of these cases that changes the radius compensation direction, thecontrol attempts to find an intersection of the actual compensated paths:Linear-to-Circular, Circular-to-Linear, or Circular-to-Circular PathsIf the control finds an intersect...

  • Page 534

    Dresser/Wheel Radius CompensationChapter 1515-46If no intersections of the actual path exist, the compensated path is thesame as if a linear-to-linear intersection had taken place (see Figure 15.39).Figure 15.39Change in Compensation With No Possible Path IntersectionsCompensated path G41Programm...

  • Page 535

    Dresser/Wheel Radius CompensationChapter 1515-47When scanning ahead, If the control does not find a motion block beforethe number of non-motion blocks has been exceeded, it does not generatethe normal radius compensation move. Instead the control sets up thecompensation move with an end-point one...

  • Page 536

    Dresser/Wheel Radius CompensationChapter 1515-48Figure 15.41Too Many Non-Motion Blocks Following a Circular MoveToo manynon-motionblocks hereToo manynon-motionblocks hereToo many non-motionblocks here++++rrrrrProgrammedpath G42CompensatedpathProgrammedpath G42CompensatedpathProgrammedpath G42Comp...

  • Page 537

    Dresser/Wheel Radius CompensationChapter 1515-49Figure 15.42Results of Example 15.13G41Too many non-motionblocks hereDresser/wheel radiuscompensationre-initialized hereProgrammedpathrrrrr12133-IFrequently the control needs to generate motion blocks to position thedresser/wheel in the proper align...

  • Page 538

    Dresser/Wheel Radius CompensationChapter 1515-50Figure 15.43Compensation Corner Movement for Two Generated BlocksThis block is eliminated if both|X1-X2| and|Z1-Z2| areless than AMP parameterX2Z2New block if blockis eliminatedX1Z1CompensatedProgrammed12134-IWhen the control generates 3 motion bloc...

  • Page 539

    Dresser/Wheel Radius CompensationChapter 1515-51If a dresser/wheel becomes excessively worn, broken, or for any otherreason requires the changing of the programmed dresser/wheel radius,radius compensation should be canceled and re-initialized after thedresser/wheel has been changed. See page 3-4 ...

  • Page 540

    Dresser/Wheel Radius CompensationChapter 1515-52Figure 15.45Linear-to-Linear Change in Dresser/Wheel Radius During CompensationNo control generatedmotion blocksWith control generatedmotion blocksCompensatedpathProgrammedpathN10N11N12CompensatedpathProgrammedpathGeneratedblocksN10N11N12N10N11 T___...

  • Page 541

    Dresser/Wheel Radius CompensationChapter 1515-53Figure 15.47 describes the path when the programmed moves arecircular-to-circular.Figure 15.47Circular to Circular Change in Dresser/Wheel Radius DuringCompensationNo control-generatedmotion blocksWith control-generatedmotion blocksProgrammedpathCom...

  • Page 542

    Dresser/Wheel Radius CompensationChapter 1515-54Regardless of how you activate the new offset, radius compensation cancompensate for this new diameter by modifying the saved jogged path.This path is modified so that the new dresser/wheel cuts the same part asthe old dresser/wheel. The absolute po...

  • Page 543

    Dresser/Wheel Radius CompensationChapter 1515-55Figure 15.48 shows an example of a typical change in dresser/wheel radiusduring jog retract with radius compensation active:Figure 15.48Change in Dresser/Wheel Radius During a Jog RetractOriginaldresser/wheelradiusNewdresser/wheelradiusDifference in...

  • Page 544

    Dresser/Wheel Radius CompensationChapter 1515-56Figure 15.49 is an example of the possible path taken when interruptingautomatic operation during radius compensation to execute MDI motionblocks. The same path would apply if interrupting radius compensation toperform a manual jog move.Figure 15.49...

  • Page 545

    Dresser/Wheel Radius CompensationChapter 1515-57Figure 15.50Compensation Re-Initialized after a Manual or MDI Operation.Manually jog axes (or any MDIexecution) and return to thecompensated path.Compensation is re-initialized here. The control assumes that the currentposition is a programmed posit...

  • Page 546

    Dresser/Wheel Radius CompensationChapter 1515-58If compensation was not canceled using a G40 command before returningto machine or secondary home points, the control automaticallyre-initializes dresser/wheel radius compensation for the return frommachine or secondary home points. This is done by ...

  • Page 547

    Dresser/Wheel Radius CompensationChapter 1515-59If compensation was not canceled using a G40 command before a changein the work coordinate system was performed, the control automaticallyre-initializes dresser/wheel radius compensation after the new workcoordinate system is established. This is do...

  • Page 548

    Dresser/Wheel Radius CompensationChapter 1515-60If necessary, the control decreases the number of available re-traceableblocks until either there are sufficient set-up buffers available tosuccessfully execute the current program, or until there are no more blockretrace blocks left. The control di...

  • Page 549

    Dresser/Wheel Radius CompensationChapter 1515-61Circular Departure Too SmallNo intersection can be generated between two consecutive compensatedpaths.Figure 15.54Typical Circular Departure ErrorProgrammedpathCompensatedpath+Compensated path necessaryto cut arcError is generatedbecause compensated...

  • Page 550

    Dresser/Wheel Radius CompensationChapter 1515-62Figure 15.55Typical Interference ErrorCompensated pathProgrammed pathError is generatedbecause compensated vec-tors crossCompensated pathnecessaryto cut arcrrr12145-IDisabling Error DetectionYou can disable all of the above error detection (with the...

  • Page 551

    Chapter1616-1Surface Grinding Fixed CyclesThis chapter describes the surface grinding cycles available with thecontrol. You can use these cycles to program axis motions to performcommon grinding operations. Topics include:Topic:On page:Surface Grinding Considerations16-2Surface Grinding Parameter...

  • Page 552

    Surface Grinding Fixed CyclesChapter 1616-2Figure 16.2 illustrates the reciprocation, plunge, and crossover motions ofa typical surface grinding cycle (G83 Incremental Plane grinding in thiscase) .Figure 16.2Reciprocation, Crossover, and Plunge MotionsCrossoverPlungepickatsecondary reversal(execu...

  • Page 553

    Surface Grinding Fixed CyclesChapter 1616-3PlanesThe operation of the surface grinding cycles is very dependent on planeselection. This chapter makes the following assumptions regarding planeconfiguration for the control. Your axis names and designations may bedifferent. See the literature provid...

  • Page 554

    Surface Grinding Fixed CyclesChapter 1616-4ReciprocationATTENTION: Reciprocation differs from conventional axismotion in that the reciprocating axis has no final destination.Once axis reciprocation begins, it continues through programblock execution until stopped by a G80 or an end of program(M02...

  • Page 555

    Surface Grinding Fixed CyclesChapter 1616-5Certain commands or commanded motions depend on reciprocation andare delayed until the reciprocating axis reaches the secondary reversalpoint. Examples of such commands include:coordinate changes requested for the reciprocating axiscertain fixed cycle op...

  • Page 556

    Surface Grinding Fixed CyclesChapter 1616-6Reciprocation stops when an emergency stop condition occurs. No motionoccurs when the emergency stop is reset. If your control’s AMP isconfigured such that the control is not reset after an E-STOP reset, thentypically reciprocation resumes with the nex...

  • Page 557

    Surface Grinding Fixed CyclesChapter 1616-7The PlungePlunge refers to the axis motion towards the part surface. You can specifytwo plunge pick increments:the plunge pick at start andthe plunge pick at crossoverParallel AxesYou can use parallel axes in the surface grinding cycle blocks in place of...

  • Page 558

    Surface Grinding Fixed CyclesChapter 1616-8Cancel Grinding and ReciprocationUse a G80 to cancel all surface grinding cycles. Programming a G80cancels a G81, G82, G83, G84, G85, or G86. When executed, a G80 alsostops the reciprocating axis.Once reciprocating motion begins, it continues through pro...

  • Page 559

    Surface Grinding Fixed CyclesChapter 1616-9I - reciprocating axis distance, secondary reversal point.If in incremental mode (G91 active) then the value entered here is a signedincremental value used to indicate the distance from the start point to theend of the secondary reciprocating motion. If ...

  • Page 560

    Surface Grinding Fixed CyclesChapter 1616-10K - cross pick amount at primary reversal.The value entered here is an incremental value used to indicate the distancethat the crossover axis moves as soon as the reciprocating axis beginsdecelerating from its primary reciprocating move.This parameter i...

  • Page 561

    Surface Grinding Fixed CyclesChapter 1616-11J - plunge pick amount at start.The value entered here is an incremental value used to indicate the distancethat the plunge axis moves as soon as the reciprocating axis beginsdecelerating. This is the plunge distance moved after the crossover axis hasre...

  • Page 562

    Surface Grinding Fixed CyclesChapter 1616-12F - cross and plunge pick feedrate.The feedrate entered here is for the cross and plunge axes. It must be withinthe range of legal F words defined for your system. If no value is enteredfor this, then the last F word executed in the part program is used...

  • Page 563

    Surface Grinding Fixed CyclesChapter 1616-13D - number of auto-dress executions.The number entered here (any integer from 0 to 999) indicates how manytimes the dress program (P) is executed over the duration of the grindingcycle. The way these dress operations are distributed throughout the cycle...

  • Page 564

    Surface Grinding Fixed CyclesChapter 1616-14The format for the G82 cycle is as follows:G17(XY);G82Z__K__X__I__Q__L__F__E__P__D__;orG82Z__K__Y__J__Q__L__F__E__P__D__;G18(ZX);G82Y__J__Z__K__Q__L__F__E__P__D__;orG82Y__J__X__I__Q__L__F__E__P__D__;G19(YZ);G82X__I__Y__J__Q__L__F__E__P__D__;orG82X__I__Z...

  • Page 565

    Surface Grinding Fixed CyclesChapter 1616-15Figure 16.4G82 Plunge Grinding MotionsSpark--out passesReciprocationSTARTIXQJYMagnetic table12048-IProgramming a G82 or G82.1 causes the control to execute a plungegrinding cycle using only two axes. You can use this cycle to grind a slotinto a part or ...

  • Page 566

    Surface Grinding Fixed CyclesChapter 1616-16Important: It is the programmer’s responsibility to make sure thatthe reciprocation moves extend beyond the part sufficiently such thatthe plunge move can be completed before the wheel comes back incontact with the part. Plunge moves begin as the reci...

  • Page 567

    Surface Grinding Fixed CyclesChapter 1616-17Figure 16.5 shows the axis motions that make up the G83 incrementalplane grinding cycle. This figure assumes that the YZ plane (G19) isactive. Since the Y axis is plane axis 1 for G19, it is the plunge axis.Figure 16.5G83 Incremental Plane Grinding Moti...

  • Page 568

    Surface Grinding Fixed CyclesChapter 1616-18For example, assume that the G19 (YZ) plane is active and you haveconfigured the Y axis as axis one and the Z axis as axis two for that plane.The cycle executes as follows:1.The X axis moves to the primary reversal point (X) at feedrate E.2.The cross pi...

  • Page 569

    Surface Grinding Fixed CyclesChapter 1616-19The format for the G84 cycle is as follows:G84X__I__Y__J__Z__K__R__Q__L__F__E__P__D__;Table 16.D summarizes the G84 cycle parameters. For a detaileddescription of these parameters, see the text below and page 16-8.Table 16.DG84 Cycle ParametersParameter...

  • Page 570

    Surface Grinding Fixed CyclesChapter 1616-20For example, assume that the G19 (YZ) plane is active and you haveconfigured the Y axis as axis one and the Z axis as axis two for that plane.The G84 cycle would execute as described for the G83 cycle except thatthe cross pick moves would be made by the...

  • Page 571

    Surface Grinding Fixed CyclesChapter 1616-21Figure 16.6 shows the axis motions that make up the G85 continuous planegrinding cycle. This figure assumes that the YZ plane (G19) is active.Since the Y axis is plane axis 1 for G19, it is the plunge axis.Figure 16.6G85 Continuous Plane Grinding Motion...

  • Page 572

    Surface Grinding Fixed CyclesChapter 1616-22For example, assume that the G19 (YZ) plane is active and you haveconfigured the Y axis as axis one and the Z axis as axis two for that plane.The cycle executes as follows:1.The X axis and the Z axis begin moving simultaneously. The X axisbegins its rec...

  • Page 573

    Surface Grinding Fixed CyclesChapter 1616-23The format for the G86 cycle is as follows:G17(XY);G86Z__K__X__I__Y__Q__L__F__E__P__D__;G18(zx);G86Y__J__Z__K__X__Q__L__F__E__P__D__;G19(YZ);G86X__I__Y__J__Z__Q__L__F__E__P__D__;Table 16.F summarizes the G86 cycle parameters. For a detaileddescription o...

  • Page 574

    Surface Grinding Fixed CyclesChapter 1616-24The G86 cycle dictates that the axis configured as axis two in the activeplane makes the plunge moves. The axis configured as axis one in theactive plane makes the crossover move, while any axis programmed that isnot in the active plane is the reciproca...

  • Page 575

    Chapter1717-1Cylindrical Grinding Fixed CyclesThis chapter describes the cylindrical grinding cycles available with thecontrol. You can use these cycles to program axis motions to performcommon grinding operations. Topics include:Topic:On page:Cylindrical Grinding Considerations17-3Cylindrical Gr...

  • Page 576

    Cylindrical Grinding Fixed CyclesChapter 1717-2Figure 17.1Cylindrical Grinding CyclesG83G82G84G85G86G87G88PartPartPartPartPartPartPart12051-IG89PartG89Part(In G16.4 mode)

  • Page 577

    Cylindrical Grinding Fixed CyclesChapter 1717-3Modality and ProgrammingThese cylindrical grinding cycles are modal. Once programmed, the cycleis executed in each subsequent block that contains the appropriateparameters and parameter values. The G codes corresponding to thesecycles do not have to ...

  • Page 578

    Cylindrical Grinding Fixed CyclesChapter 1717-4Figure 17.2Typical Axis ConfigurationCylindrical grinding axisconfiguration assumedin this manual.XZ+----Part12052-IAngled-Wheel ModeAngled-wheel grinders (grinders that have a wheel axis that is notperpendicular to Z) have three operating modes. The...

  • Page 579

    Cylindrical Grinding Fixed CyclesChapter 1717-5ReciprocationATTENTION: Reciprocation differs from conventional axismotion in that the reciprocating axis has no final destination.Once axis reciprocation begins, it continues through programblock execution until stopped by a G80, an end of program(M...

  • Page 580

    Cylindrical Grinding Fixed CyclesChapter 1717-6Certain commands or commanded motions depend on reciprocation andare delayed until the reciprocating axis reaches the secondary reversalpoint. Following are examples of such commands:coordinate changes requested for the reciprocating axiscertain fixe...

  • Page 581

    Cylindrical Grinding Fixed CyclesChapter 1717-7Reciprocation stops when an emergency stop condition occurs. No motionoccurs when the emergency stop is reset. If your control’s AMP isconfigured such that the control is not reset after an E-STOP reset, thentypically reciprocation resumes with the...

  • Page 582

    Cylindrical Grinding Fixed CyclesChapter 1717-8If a plunge shift is made (G84 or G85), it is not made until the spark-outpasses are completed, the dither motion has stopped, and the plunge axishas retracted to its start coordinate. As the plunge axis decelerates, theplunge shift (Q) is executed.P...

  • Page 583

    Cylindrical Grinding Fixed CyclesChapter 1717-9Once reciprocating motion begins, it continues through program blockexecution until a G80 is executed. If there is no G80, reciprocationcontinues until an end of program (M02, M30, M99), or an emergency stopcondition occurs. An M99 in a subprogram si...

  • Page 584

    Cylindrical Grinding Fixed CyclesChapter 1717-10This parameter is the system F word. Programming it here alters thefeedrate for any subsequent axis motion. Programming F0 selects therapid feedrate.E -- reciprocation, dither, or shoulder feedrate. The feedrate enteredhere is for the reciprocating ...

  • Page 585

    Cylindrical Grinding Fixed CyclesChapter 1717-11This parameter is not “program modal.” If a value for the number of dressexecutions is not programmed, then the dress program P is not executedfor that cycle. This does not affect pre-dress requests or operator requesteddressing as described in ...

  • Page 586

    Cylindrical Grinding Fixed CyclesChapter 1717-12The format for the G82 cycle is as follows:G18;G82X__I__Z__K__Q__L__F__E__P__D__;Table 17.B summarizes the G82 cycle parameters. For a detaileddescription of these parameters, see the text below and page 17-9.Table 17.BG82 Cycle ParametersParameter:...

  • Page 587

    Cylindrical Grinding Fixed CyclesChapter 1717-13Figure 17.3G82 Incremental Face Grinding MotionsPartKReciprocationXSTARTIQZSpark--out passes12053-IProgramming a G82 causes the control to execute a face grinding cycle.This cycle is typically used to grind the face of a part. Axis 2, the X axisin o...

  • Page 588

    Cylindrical Grinding Fixed CyclesChapter 1717-145.The reciprocation and plunge pick moves continue until the plungedepth (Z) is reached.6.After the plunge depth (Z) is reached, reciprocation continues andthe programmed number of spark-out passes are executed.The following describes each of the cy...

  • Page 589

    Cylindrical Grinding Fixed CyclesChapter 1717-15Important: In grinding fixed cycle blocks where changes are made fromabsolute to incremental or incremental to absolute modes within the block,the integrands I, J and K are always in the last mode programmed in theblock, regardless of their position...

  • Page 590

    Cylindrical Grinding Fixed CyclesChapter 1717-16The format for the G83 cycle is as follows:G18;G83Z__K__X__I__Q__L__F__E__P__D__;Table 17.C summarizes the G83 cycle parameters. For a detaileddescription of these parameters, see the text below and page 17-9.Table 17.CG83 Cycle ParametersParameter:...

  • Page 591

    Cylindrical Grinding Fixed CyclesChapter 1717-17Figure 17.4G83 Incremental Plunge Grinding MotionsPartXIReciprocationZSTARTKQSpark--out passes12054-IProgramming a G83 causes the control to execute a plunge grinding cycle.This cycle is typically used to grind the diameter of a part. Axis 1, the Za...

  • Page 592

    Cylindrical Grinding Fixed CyclesChapter 1717-185.The reciprocation and plunge pick moves continue until the plungedepth (X) is reached.6.After the plunge depth (X) is reached, reciprocation continues andthe programmed number of spark-out passes are executed.The following describes each of the cy...

  • Page 593

    Cylindrical Grinding Fixed CyclesChapter 1717-19Important: In grinding fixed cycle blocks where changes are made fromabsolute to incremental or incremental to absolute modes within the block,the integrands I, J and K are always in the last mode programmed in theblock, regardless of their position...

  • Page 594

    Cylindrical Grinding Fixed CyclesChapter 1717-20The format for the G84 cycle is as follows:G18;G84X__I__Z__Q__L__F__E__P__D__;Table 17.D summarizes the G84 cycle parameters. For a detaileddescription of these parameters, see the text below and page 17-9.Table 17.DG84 Cycle ParametersParameter:Def...

  • Page 595

    Cylindrical Grinding Fixed CyclesChapter 1717-21Figure 17.5G84 Multi-pass Face Grinding MotionsRetractILXZQSTARTPart12055-IProgramming a G84 causes the control to execute a multi-pass facegrinding cycle. This cycle is typically used to grind the face of a part in asituation where a shifting of th...

  • Page 596

    Cylindrical Grinding Fixed CyclesChapter 1717-22The following describes each of the cycle’s parameters.X -- last plunge point. If in incremental mode (G91 active) then the valueentered here is a signed incremental value indicating the distance from thestart point to the point where the last plu...

  • Page 597

    Cylindrical Grinding Fixed CyclesChapter 1717-23If no value is entered for Q then no shift is made. If a value greater than orequal to X is entered, then the shift is made only to the last plunge pointdefined by X. If the sign of the value entered here sends the axis awayfrom the last plunge poin...

  • Page 598

    Cylindrical Grinding Fixed CyclesChapter 1717-24Figure 17.6G85 Multi-pass Diameter Grinding MotionsRetractKSpark-outpassesZXQSTARTPart12056-IProgramming a G85 causes the control to execute a multi-pass diametergrinding cycle. This cycle is typically used to grind the diameter of a partin a situat...

  • Page 599

    Cylindrical Grinding Fixed CyclesChapter 1717-25The third and most significant difference between the G85 and the G83cycles is that the G85 incorporates a Z axis shift, made after thecompletion of each plunge. The length of this shift (distance betweenplunges) is defined by the Q parameter.The fo...

  • Page 600

    Cylindrical Grinding Fixed CyclesChapter 1717-26Q -- plunge shift. The value entered here is an incremental value used toindicate the distance that the Z axis is to shift after the plunge axis hasretracted. This shift takes place after the plunge axis has retracted and isexecuted at the rapid fee...

  • Page 601

    Cylindrical Grinding Fixed CyclesChapter 1717-27Figure 17.7G86 Shoulder Grinding MotionsPartSTARTRetractZ, X Vector feed12057-IProgramming a G86 causes the control to execute a single vector move tothe programmed axis 1 (Z) and axis 2 (X) plunge end points at the plungefeedrate F. If a number of ...

  • Page 602

    Cylindrical Grinding Fixed CyclesChapter 1717-28The format for the G87 cycle is as follows:G18;G87Z__X__L__F__E__P__;Table 17.G summarizes the G87 cycle parameters. For a detaileddescription of these parameters, see the text below and page 17-9.Table 17.GG87 Cycle ParametersParameter:Definition:D...

  • Page 603

    Cylindrical Grinding Fixed CyclesChapter 1717-29If a number of spark-out revolutions (L) is programmed in the block, theaxes dwell at the plunge and shoulder depth for the designated number ofrevolutions of the spindle. Then they simultaneously retract to the startposition at the rapid feedrate. ...

  • Page 604

    Cylindrical Grinding Fixed CyclesChapter 1717-30The format for the G88 cycle is as follows:G18;G88Z__X__L__F__E__P__;Table 17.H summarizes the G88 cycle parameters. For a detaileddescription of these parameters, see the text below and page 17-9.Table 17.HG88 Cycle ParametersParameter:Definition:D...

  • Page 605

    Cylindrical Grinding Fixed CyclesChapter 1717-31Programming a G88 causes the control to execute two moves to arrive atthe final plunge position. First axis 2 (X) plunges into the part diameter atfeedrate F. Then axis 1 (Z) makes a shoulder grind at feedrate E.If a number of spark-out revolutions ...

  • Page 606

    Cylindrical Grinding Fixed CyclesChapter 1717-32The G89 cycles contain special features that separate it from otheravailable cycles. These features include:Three independent plunge steps occurring at three independent plungefeedrates.A micro-feed feature compensates for any wheel wear that occurs...

  • Page 607

    Cylindrical Grinding Fixed CyclesChapter 1717-33Figure 17.10G89 Multi-Step Plunge with BlendPart@F@E@,F@,ERIQRapid MovesKStart PointPart@F@E@,F@,ERIQKStart PointAngled-Wheel Grinders in Two Step Grinding Mode (G16.4)Non-Angled Wheel Grinders orAngled-Wheel Grinders in Normal Grinding Mode (G16.3)...

  • Page 608

    Cylindrical Grinding Fixed CyclesChapter 1717-34The following describes each of the cycle’s parameters.X -- plunge end pointIf in absolute mode (G90 active) then the value entered here is the Xcoordinate of the plunge end point.If in incremental mode (G91 active) then the value entered here is ...

  • Page 609

    Cylindrical Grinding Fixed CyclesChapter 1717-35I -- medium plunge distanceI defines the medium plunge distance. If I is programmed it also definesthe endpoint of the previous plunge motion (end point of rough plunge if Ris programmed or rapid if no rough plunge is programmed). If I is notprogram...

  • Page 610

    Cylindrical Grinding Fixed CyclesChapter 1717-36E -- medium plunge feedrateThe feedrate entered here is for the medium plunge phase programmedwith I. E must be within the range of legal F words defined for yoursystem. The Single Digit F Word feature can not be used to assign E wordvalues. If no v...

  • Page 611

    Cylindrical Grinding Fixed CyclesChapter 1717-37P -- dress program numberThe number entered here must be a legal program number (a program thathas been saved as a subprogram or macro using the O word followed by anumber of up to five digits). This dress program is used for the pre-dressoperation....

  • Page 612

    Cylindrical Grinding Fixed CyclesChapter 1717-38Normal single-step grinders are:Any non-angled wheel grinder (all linear axes are perpendicular)Angled-wheel grinders executing in the normalangled-wheel mode (G16.3).Figure 17.11 shows the axis motions that make up the G89 multi-stepplunge with ble...

  • Page 613

    Cylindrical Grinding Fixed CyclesChapter 1717-394.The X axis plunges to the final depth programmed for X at thefeedrate ,F. If the system installer has configured and activated amicro-feed, it takes place in this phase. Any micro-feed amountextends the plunge endpoint beyond the programmed X plun...

  • Page 614

    Cylindrical Grinding Fixed CyclesChapter 1717-40Execution of the G89 multi-step plunge with blend cycle performs thefollowing moves:1.All Z axis motion that must occur to reach the proper Z endpoint bythe end of the plunge takes place first. This move takes place at therapid feedrate.2.The W axis...

  • Page 615

    Cylindrical Grinding Fixed CyclesChapter 1717-41Figure 17.13G89 Plunge with Micro-Feed@F@E@,FRIQRapid MovesStart PointX@,FMicro-FeedNormal Mode PlungeTwo-Step Mode Plunge@F@E@,FRIQStart PointXMicro-FeedProg. ZProg. ZWhen the rapid positioning at the start of the cycle ends, the control checksto s...

  • Page 616

    Cylindrical Grinding Fixed CyclesChapter 1717-42ATTENTION: Overcutting of the shoulder can occur when amicro-feed is performed on an angled-wheel grinder operatingin G16.4 two step angled wheel grinder mode. All micro-feedmotion in G16.4 mode occurs on the W axis. No transformationof Z axis motio...

  • Page 617

    Chapter1818-1Turning OperationsTurning operations generate a series of predetermined grinding/dressingmotions to turn or thread a part. The major topics covered in this chapterinclude:Topic:On Page:Single Pass Turning Cycles18-1Single Pass O.D. and I.D. Roughing Cycle (G20)18-2Single Pass Rough F...

  • Page 618

    Turning OperationsChapter 1818-2This manual assumes that your system is configured to repeat the cycleonly after blocks that command axis motion.Cancel single pass cycles by programming a different G code in the samemodal group (see G code table in Appendix C). G codes in the same groupinclude G0...

  • Page 619

    Turning OperationsChapter 1818-3ATTENTION: When programming the single pass cycle, thefirst move to the grinding/dressing depth is a rapid move. Makesure that the grinding wheel or dresser does not contact the parton this initial move.The single pass cycle uses the currently active programmedgrin...

  • Page 620

    Turning OperationsChapter 1818-4Figure 18.2Results of Example 18.1X2535Grinding/Dressing feedRapid feedZ202428Grindingwheel12061-IG20 Taper O.D. and I.D. Grinding/DressingA G20 block that includes an I word generates a grinding/dressing passthat produces a taper. The format to grind/dress a taper...

  • Page 621

    Turning OperationsChapter 1818-5Figure 18.3G20 Taper Grinding CycleGrinding/Dressing feedRapid feedIZXGrindingwheel12062-IAfter the control executes the G20 block, it re-executes the cycle for anyfollowing block that command axis motion (until the cycle is canceled).The values of the axis words i...

  • Page 622

    Turning OperationsChapter 1818-6Example 18.2Taper GrindingG90G00X50.Z106.;G20X38.Z46.I-11.F.5;X32.;X26.;X20.;Figure 18.5Results of Example 18.2Grinding/Dressing feedRapid feed11604638322620ZXGrindingwheel12064-I

  • Page 623

    Turning OperationsChapter 1818-7G24 calls either a straight or a tapered facing cycle. This cycle is a singlepass cycle (makes only one grinding pass over the workpiece or onedressing pass over the wheel each time it is called).Use the G24 cycle to grind along the face of a workpiece (in this man...

  • Page 624

    Turning OperationsChapter 1818-8G24 Straight FacingThe format for the G24 straight facing cycle is:G24X__ Z__;Where :Is :X__the length of grind along the X-axis. In incremental mode, specify the amount offeed across the part. In absolute mode, specify the coordinate position of theend point of th...

  • Page 625

    Turning OperationsChapter 1818-9G24 Tapered FacingA G24 block that includes a K word generates a facing pass that produces ataper.Figure 18.8G24 Face Taper Grinding/Dressing CycleXKZGrinding/Dressing feedRapid feedGrindingwheel12067-IThe format for the G24 single pass cycle to grind a taper on a ...

  • Page 626

    Turning OperationsChapter 1818-10After the control executes the G24 block, the control re-executes the cyclefor any following block that commands axis motion (until the cycle iscanceled). The values of the axis words in the following block replace thevalues of the parameters specified in the orig...

  • Page 627

    Turning OperationsChapter 1818-11Example 18.4Tapered Face GrindingG90G00X43.Z55.;G24X10.Z50.K-10.F10.;Z45.;Z40.;G00;Figure 18.10Results of Example 18.4X4035301010ZGrinding/Dressing feedRapid feedGrindingwheel12069-I

  • Page 628

    Turning OperationsChapter 1818-12The control provides turning operations for single pass thread grinding.The single pass thread grinding operating modes are enabled byprogramming a G33 or a G34. G33 mode grinds straight, tapered, face,multi-start, and multi-block threads. G34 mode grinds thread p...

  • Page 629

    Turning OperationsChapter 1818-13Axis feedrates - When threading, the speed of the grinding axis isdetermined by the spindle speed and the thread lead through thefollowing equation:axis feedrate = (S) / (F threads per inch)= (S) / (E threads per inch)= (S)(E inches per thread)Where : Is :Sthe act...

  • Page 630

    Turning OperationsChapter 1818-14Figure 18.11Angular versus Plunge InfeedGrinding WheelGrinding WheelAngular InfeedPlunge Infeed12070-IWhen threading, you must program a small Z move to generate an angularinfeed.The G33 single pass thread grinding mode grinds straight, tapered, face,and multi-sta...

  • Page 631

    Turning OperationsChapter 1818-15The format for the G33 thread grinding operation is:Parallel threadG33Z__F__Q__;ETapered threadG33X__Z__F__Q__;EFace threadG33X__F__Q__;EWhere :Is :Xthe end point of the thread grinding move in the X-axis. This parameter can bean incremental or absolute and radius...

  • Page 632

    Turning OperationsChapter 1818-16Figure 18.13G33 Block ParametersZInc.ZAbs.ZXAbs.XInc.XQ1/E or 1/FGrinding Wheel12072-IExample 18.5Parallel Thread GrindingThread lead:5 threads/inch (.20 inch pitch)Depth of grind:.1 pitchNumber of grinding passes:2N1G00X1.5Z2.2;N2X.9;N3G33Z.8E5.;N4G00X1.5;N5Z2.2;...

  • Page 633

    Turning OperationsChapter 1818-17Figure 18.14Results of Parallel Thread Grinding Example 18.5ZX0.70.91.50.82.21.0N1N2N6N4N8N5N9N3N7GrindingWheel12073-IIf you program both E and F in the same block, the right-most parametertakes effect for that block.The programmed lead remains in effect until ano...

  • Page 634

    Turning OperationsChapter 1818-18When using the X-axis as the thread lead axis for E or F, program threadleads as radial values.Example 18.6Tapered Thread GrindingThread lead: .125 threads/mm (8 mm pitch)Depth of grind:1 mm (X direction)Number of grinding passes:2N1G77G00X20.Z4.;N2G33X48.Z-47.F8;...

  • Page 635

    Turning OperationsChapter 1818-19The G34 single pass variable lead thread grinding mode grinds straight,tapered, face, and multi-start threads that do not have a constant threadlead. It is programmed almost identically to the G33 thread grinding modewith the addition of a K word used to program t...

  • Page 636

    Turning OperationsChapter 1818-20Where :Is :EFThis parameter may be entered by using either an E- or F-word. It represents thethread lead along the axis with the largest programmed distance to travel to makethe thread cut. It is mandatory when cutting any threads.If the E-word is programmed, its ...

  • Page 637

    Turning OperationsChapter 1818-21Figure 18.18Results of Variable Lead Face Threading Example 18.7Z37.59.557.047.5mm.1 thread/mm(10mm pitch).526 thread/mm(1.9 mm pitch)X.171 thread/mm(5.833mm pitch)GrindingWheel12077-IThe lead changes continuously during the move. At any point during themove, you ...

  • Page 638

    Turning OperationsChapter 1818-22

  • Page 639

    Chapter1919-1Skip and Gauge Probing CyclesExternal skip functions are motion-generating G-code blocks that can beaborted when the control receives an external signal through the PALprogram. Gauging functions are similar to the external skip functionsexcept that you can use the axis coordinates (a...

  • Page 640

    Skip and Gauge probing CyclesChapter 1919-2ATTENTION: We do not recommend using a skip block fromany fixed cycle block (such as multi-pass face grinding or aturning). If you do choose to execute a skip block in a fixedcycle mode, be aware that the block that is skipped when thetrigger occurs can ...

  • Page 641

    Skip and Gauge probing CyclesChapter 1919-3Important: The move that immediately follows a G31 series external skipblock cannot be a circular move.The coordinates of the axes when the external skip signal is received areavailable as the paramacro system parameters #5061-#5066 (workcoordinate syste...

  • Page 642

    Skip and Gauge probing CyclesChapter 1919-4The format for any G37 skip block is:G37 Z__ F__;Where :Is :G37any of the G codes in the G37 series. Use the one that is configured to respondto the current skip signal device that is being used.X, Zthe axis on which the length offset measurement is to b...

  • Page 643

    Skip and Gauge probing CyclesChapter 1919-5Important: The move that immediately follows a G37 series skip blockcannot be a circular move.Your system installer determines in AMP if the new value is added to orreplaces the old value in the table. Your system installer also determines inAMP which ga...

  • Page 644

    Skip and Gauge probing CyclesChapter 1919-6Figure 19.1Typical Wheel Gauging ConfigurationsProbeProberadiusProbeProberadiusProbeProberadiusProbelengthCase 1Case 2Case 3+Z--X--X12078-IFigure 19.1 illustrates 3 typical wheel gauging configurations. All 3 casesassume that the probe is at a known fixe...

  • Page 645

    Chapter2020-1ParamacrosParamacros are similar to subprograms, with many added features. Useparamacros to create custom cycles that may require complexmathematical calculations, access to wheel offset, work coordinates, wheelposition data, and the ability to alter normal program execution. The maj...

  • Page 646

    ParamacrosChapter 2020-2This subsection covers the basic mathematical operators that are availableon the control. Use these operators to accomplish mathematical operationsnecessary to evaluate basic mathematical equations, such as addition,multiplication, etc. Table 20.A lists the basic mathemati...

  • Page 647

    ParamacrosChapter 2020-3All logical operators have the format of:A logical operator Bwhere:- A and B are numerical data or a parameter with a value assigned to it- B cannot be negative or an error occurs- if A is negative, the absolute value of A is used in the operation andthe sign is attached t...

  • Page 648

    ParamacrosChapter 2020-4Table 20.BMathematical FunctionsFunctionMeaningSINSine (degrees)COSCosine (degrees)TANTangent (degrees)ATANArc Tangent (degrees)ASINArc Sine (degrees)ACOSArc Cosine (degrees)SQRTSquare RootABSAbsolute ValueBINConversion from BCD to DecimalBCDConversion from Decimal to BCDR...

  • Page 649

    ParamacrosChapter 2020-5Example 20.4Mathematical Function Examples.Expression EnteredResultSIN[90]1.0SQRT[16]4.0ABS[-4]4.0BIN[855]357BCD[357]855ROUND[12.5]13.0ROUND[12.49]12.0FIX[12.7]12.0FUP[12.2]13.0FUP[12.0]12.0LN[9]2.197225EXP[2]7.389056Important: Take precautions when performing calculations...

  • Page 650

    ParamacrosChapter 2020-6You can use parametric expressions to specify G-codes or M-codes in aprogram block.For example:G#1 G#100 G#500 M#1 M#100 M#500;G#520 G[#521-1] G[#522+10] M#520 M[#522+1] M[#522+10];When using a parametric expression to specify a G-- or M-code, remember:When specifying more...

  • Page 651

    ParamacrosChapter 2020-7Attempting to use any of the above as MDI commands, 9/PC generates an“ILLEGAL MACRO CMD VIA MDI” error message.This section contains the following subsections:Topic:On page:Conditional Operators20-7GOTO and IF-GOTO Commands20-9DO-END and WHILE-DO Commands20-10Use trans...

  • Page 652

    ParamacrosChapter 2020-8Table 20.CConditional OperatorsOperatorCondition TestedEQEqualNENot equalGTGreater thanLTLess thanGEGreater than or equalLELess than or equalA condition is programmed between the [ and ] brackets in the followingformat:[A EQ B]where:- A and B represent some numerical value...

  • Page 653

    ParamacrosChapter 2020-9Unconditional GOTOUse the unconditional GOTO command to automatically transfer controlany time that the GOTO block is executed.The format for the GOTO command is:GOTO n;Where:Specifies:nthe sequence number of the block to which execution is transferred when theGOTO block i...

  • Page 654

    ParamacrosChapter 2020-10Example 20.8 illustrates the use of the conditional IF-GOTO command.Example 20.8Conditional IFN1...;N2IF[#3EQ-1.5]GOTO5;N3...;N4...;N5...;N6IF[#4LT3]GOTO1;N7...;When block N2 is read, parameter #3 is compared to the value -1.5. If thecomparison is true, blocks N3 and N4 a...

  • Page 655

    ParamacrosChapter 2020-11All blocks between the DO and the END command are executedindefinitely or until execution is transferred to some block out of the loopor stopped by some external operation such as pressing <CYCLE STOP>or <E-STOP>.Conditional WHILE-DO-ENDThe conditional WHILE-D...

  • Page 656

    ParamacrosChapter 2020-12In Example 20.9, blocks N2 through N6 are executed 9 times. At that timethe condition in block N2 becomes false and program execution istransferred to block N7.Nesting is possible with a WHILE-DO-END command. We definednesting as one WHILE-DO-END program segment executing...

  • Page 657

    ParamacrosChapter 2020-13The following subsections cover these different types of parametersindependently. This does not mean that they are not interchangeable in thesame macro program. Mixing the different types of parameters in the sameparamacro is acceptable.Local parameters are #1 - #33. Ther...

  • Page 658

    ParamacrosChapter 2020-14Considerations for local parametersYou must consider the following when assigning values to localparameters:All local variable assignments are reset to zero any time the controlreads an M02, or M30 in a part programAll local variable assignments are reset to zero any time...

  • Page 659

    ParamacrosChapter 2020-15Example 20.13Assigning The Same Parameter Twice Using I, J, and KG65P1001R2I3.4D5I-0.6The above blocks set the following parameters:parameter #18 = 2 As set by the R word.parameter #4 = 3.4 As set by the 1st I word.parameter #7 = -0.6 As set by the 2nd I word.The value 5,...

  • Page 660

    ParamacrosChapter 2020-16You can use system parameters in any part program, including paramacrosand subprograms. All of these parameters can be used as data or can bechanged by assignment (read and write) unless indicated differently inTable 20.D. System parameters are generated by the control an...

  • Page 661

    ParamacrosChapter 2020-175500 to 5509In-Process Dresser Parameters20-325600 to 5625Part Program Block Create through PAL Display Pages20-33Table 20.DSystem Parameters (continued)Parameter #System ParameterPage56301 S--Curve Time per Block20-335661 to 56421 Acceleration Ramps for Linear Acc/Dec Mo...

  • Page 662

    ParamacrosChapter 2020-18#2001 to 2732Dresser/Wheel Offset TablesUse these parameters to enter dresser/wheel offset values into thedresser/wheel offset tables for geometry and radius (as covered in chapter3). They can be changed or simply read through programming.Table 20.E lists the parameter nu...

  • Page 663

    ParamacrosChapter 2020-19For example, programming:#3000=.1 (WHEEL NUMBER 6 IS WORN);causes program execution to stop at the beginning of this block and displaya message telling the operator to read the comment in the block. A blockreset must be performed before a cycle start can resume normal pro...

  • Page 664

    ParamacrosChapter 2020-20Value of ParameterResult0Single block mode can be activated and M-codes are executed at thebeginning of the program block’s execution.1Single block mode requests are ignored and M-codes are executed atthe beginning of the program block’s execution.2Single block mode c...

  • Page 665

    ParamacrosChapter 2020-21#3006Program Stop With MessageUse this parameter to cause a cycle stop operation and display a messageon line 1 of the CRT. It is a write-only parameter. Any block that assignsa new value to parameter #3006 results in a cycle stop. Any value can beassigned to this paramet...

  • Page 666

    ParamacrosChapter 2020-22#3007Mirror ImageUse this parameter to monitor which axes are mirrored. It is a read-onlyparameter. This parameter is an integer that represents, in binary, whichaxes are mirrored.For example, if the value of this parameter was 3, the binary equivalent forthis is 00000011...

  • Page 667

    ParamacrosChapter 2020-23Table 20.GModal Data ParametersParameter NumberModal Data Value#4001 to 4021G-code Groups 1-21 (see page 20-54) and list what G-code fromwhich group is currently active.4108Current E word value4109Current F word value4113Most recently programmed M-code4114Most recently pr...

  • Page 668

    ParamacrosChapter 2020-24#5021 to 5032Coordinates of Commanded PositionThese parameters are read-only. They correspond to the currentcoordinates of the cutting tool. These are the coordinates in the workcoordinate system.5021Axis 1 coordinate position5027Axis 7 coordinate position5022Axis 2 coord...

  • Page 669

    ParamacrosChapter 2020-25#5061 to 5069 or #5541 to 5552Skip Signal Position Work Coordinate PositionThese parameters are read-only. They correspond to the coordinates of thecutting tool when a skip signal is received to PAL from a probe or other devicesuch as a switch. These are the coordinates i...

  • Page 670

    ParamacrosChapter 2020-26#5071 to 5079 or #5561 to 5562Skip Signal Position Machine Coordinate SystemThese parameters are read-only. They correspond to the coordinates of thecutting tool when a skip signal is received to PAL from a probe or otherdevice such as a switch. These are the coordinates ...

  • Page 671

    ParamacrosChapter 2020-27#5081 to 5089 or #5581 to 5592 Active Tool Length OffsetsThese are read-only parameters. They correspond to the currently activetool length offsets (see chapter 20).5081Current axis 1 tool length offset.5087Current axis 7 tool length offset.5082Current axis 2 tool length ...

  • Page 672

    ParamacrosChapter 2020-28#5095 and 5096Probe Length and RadiusProbe tip radius and probe length are defined by your system installer inAMP. These values can also be changed by using these paramacro systemparameters:5095Length of Probe -- used primarily for G37 operations. This distance is measure...

  • Page 673

    ParamacrosChapter 2020-29#5101 to 5112Current Following ErrorThese parameters are read-only. They correspond to the current followingerror for an axis.5101Axis 1 following error5107Axis 7 following error5102Axis 2 following error5108Axis 8 following error5103Axis 3 following error5109Axis 9 follo...

  • Page 674

    ParamacrosChapter 2020-30#5221 to 5392Work Coordinate Table ValueThese parameters are read or write. They correspond to the current value setin the work coordinate table for the G54-G59 work coordinate systems (seeChapter 3). You can read data from the tables and set data into the table byassigni...

  • Page 675

    ParamacrosChapter 2020-31#5221 to 5392Work Coordinate Table Value (continued)5261G56 Axis 1 Coordinate5361G59.2 Axis 1 Coordinate5262G56 Axis 2 Coordinate5362G59.2 Axis 2 Coordinate5263G56 Axis 3 Coordinate5363G59.2 Axis 3 Coordinate5264G56 Axis 4 Coordinate5364G59.2 Axis 4 Coordinate5265G56 Axis...

  • Page 676

    ParamacrosChapter 2020-32#5500 to 5508In-Process Dresser ParametersUse these parameters to assign values to the in-process dresser operation.These parameters are read/write. Details on what these parametersrepresent to the in-process dresser are covered in chapter 21. Thein-process dresser parame...

  • Page 677

    ParamacrosChapter 2020-33#5600 to 5625Part Program Block Create Through PAL Display PagesUse these parameters to assign numeric values to their correspondingblock letter codes during part program block creation through PAL displaypages. They are read or write parameters. Your system installer mus...

  • Page 678

    ParamacrosChapter 2020-34#5631 to 5642Acceleration Ramps for Linear Acc/Dec ModeThese parameters are read only. They correspond to the active accelerationramps in Linear Acc/Dec mode. You can set these parameters byprogramming a G48.1 in your part program block. Control Reset, ProgramEnd (M02/M03...

  • Page 679

    ParamacrosChapter 2020-35#5671 to 5682Acceleration Ramps for S- Curve Acc/Dec ModeThese parameters are read only. They correspond to the active accelerationramps in S--Curve Acc/Dec mode. You can set these parameters byprogramming a G48.3 in your part program block. Control Reset, ProgramEnd (M02...

  • Page 680

    ParamacrosChapter 2020-36#5711 to 5722JerkThese parameters are read only. They are only applicable to the current jerkvalues when S--Curve Acc/Dec mode is active. You can set these parametersby programming a G48.5 in your part program block. Control Reset,Program End (M02/M03), or G48 will reset ...

  • Page 681

    ParamacrosChapter 2020-37#5751 to 5763Home Marker ToleranceThese parameters are read only. They correspond to the current home markertolerance. These parameters will contain the tolerance value at power turn onand will represent 3/8 of an electrical cycle of the feedback device convertedto curren...

  • Page 682

    ParamacrosChapter 2020-38The control always interprets these PAL parameters as integer valuesregardless of how they are assigned in PAL (as an integer or on a perbit basis). #1032 is the only parameter that can also be interpreted bythe control on a per-bit basis using parameters #1000 - #1031. P...

  • Page 683

    ParamacrosChapter 2020-39#1132 -- #1135 and #1172 -- #1175The control always interprets these parameters as integer values. #1132is the only parameter that may also be interpreted by the part programon a per-bit basis using parameters #1100 -- #1131.The second set of parameters, #1172 -- #1175, f...

  • Page 684

    ParamacrosChapter 2020-40calling the paramacro), followed by the value to assign that parameter. Forexample:G65P1001A1.1 B19;assigns the value of:1.1 to local parameter #1 in paramacro 100119 to local parameter #2 in paramacro 1001Arguments can be specified as any valid parametric expression. For...

  • Page 685

    ParamacrosChapter 2020-41Table 20.HArgument Assignments(A)(B)*WordAddressParameterAssignedI, J, KSet #WordAddressParameterAssignedA#11I#4B#2J#5C#3K#6D#72I#7E#8J#8F#9K#9H#113I#10I*#4J#11J*#5K#12K*#64I#13M#13J#14Q#17K#15R#185I#16S#19J#17T#20K#18U#216I#19V#22J#20W#23K#21X#247I#22Y#25J#23Z#26K#248I#2...

  • Page 686

    ParamacrosChapter 2020-42Direct Assignment Through ProgrammingThis assignment method applies to local, common, system, and PALparameters. You can perform direct assignment in main, macro, or MDIprograms. Direct assignment is done by setting the parameter equal tosome value in an equation using th...

  • Page 687

    ParamacrosChapter 2020-43If using multiple assignments in the same block, remember the following:You can enter as many assignments as can be typed into one block (127characters maximum)For local and common parameters, block execution is from left to right.For example:#1 = 10,#2=#1+2;When executed...

  • Page 688

    ParamacrosChapter 2020-44The macro parameters are separated into 4 tables that are accessedthrough softkeys. Table 20.I lists these softkeys, the parametersaccessed through them, and additional information on the parameters.Table 20.IMacro Parameter TablesSoftkey:Used to:{LOCAL PARAM}View the loc...

  • Page 689

    ParamacrosChapter 2020-45Move the cursor an entire page by pressing the up or down cursor keywhile holding down the [SHIFT] key.You can also perform a rapid search for the desired parameter number.To do so, press the {SEARCH NUMBER} softkey, key in theparameter number you want, and then press the...

  • Page 690

    ParamacrosChapter 2020-464.Select the softkey to alter the common parameter values.(softkey level 3)SEARCHNUMBERREPLCEVALUEZEROVALUE0 ALLVALUESREFRSHSCREENIf you press the {COM-2A PARAM} softkey (in step 2), theseoptions are also available to alter the parameter name:To edit an existing parameter...

  • Page 691

    ParamacrosChapter 2020-47Addressing Assigned ParametersOnce you assign a parameter you can address it in a program:Example 20.16Addressing Assigned Parameters#100=5;#105=8;G01X#100+5 ;Axis moves to 10.G01x[#100+5]Axis moves to 8You can also indirectly address parameters with other parametersExamp...

  • Page 692

    ParamacrosChapter 2020-481.Press the appropriate BACKUP softkey.The system prompts you for a file name.2.Enter a name for the backup file and press [TRANSMIT].The system verifies the file name and backs up the selectedparameters into the specified part program. You can restore theseparameters by ...

  • Page 693

    ParamacrosChapter 2020-49You can use a paramacro call to call any program that has a program nameof up to 5 numeric digits following the letter O (see page 10-8 for detailson program names). This program must also contain an M99 end ofsubprogram or macro code somewhere in the program before an M0...

  • Page 694

    ParamacrosChapter 2020-50Use this format when calling a paramacro using the G65 command:G65 P_ L_ A_ B_;Where:Determines:Pthe program number of the called macro. P ranges from 1 - 99999.Lthe number of times the macro is executed. L ranges from 1 - 9999, and can beexpressed as any valid parametric...

  • Page 695

    ParamacrosChapter 2020-51motions called for by that block first. After that block has been executed,the control calls the macro specified by the G66 block.This macro is executed until the control reaches an M99 macro return code.The macro then returns to the next unexecuted sequential block in th...

  • Page 696

    ParamacrosChapter 2020-52Example 20.19 illustrates modal macro operation.Example 20.19Modal Macro Operation(MAIN);O1000;NO10G90;N020G66P1001L2A1.1;N030X1;N040Z.25N050G66P1002A2;N060X1.;N070G67;N090G67;N100M30;Parameter #1 is set at 1.1 in macro 1001.X Axis is moved 1 unit and then macro 1001 is c...

  • Page 697

    ParamacrosChapter 2020-53The G66.1 command is modal and is executed in the same manner as theG66 with these exceptions:The macroprogrammedbythe P wordinthe G66block is not executedwhen the G66 block is read, whereas the macro programmed by theG66.1 is executed when G66.1 is read.The macro is exec...

  • Page 698

    ParamacrosChapter 2020-54Any time the macro is called (while executing the G66.1), the L wordprogramming the number of repetitions is in effect. Any attempt tore-program an L word outside of a G66.1 block is interpreted as anargument assignment for parameter #12.Important: When nesting a macro (a...

  • Page 699

    ParamacrosChapter 2020-55Important: Your system installer can disable the use of AMP-defined Gand M-code macro calls when in MDI mode. See your system installer’sdocumentation to determine if this feature is functional in MDI.AMP-defined G-code macros can be executed as either modal ornon-modal...

  • Page 700

    ParamacrosChapter 2020-56Important: Your system installer can optionally disable the use ofAMP-defined G and M-code macro calls when in MDI mode. See yoursystem installer’s documentation to determine if this feature is functionalin MDI.Important: Certain AMP-defined M-code macro calls cannot be...

  • Page 701

    ParamacrosChapter 2020-57An AMP flag for that specific word must be turned on by your systeminstaller to allow that word to call a macro.The value for an AMP-defined T-, S-, or B-code command has the sameformat and range as an ordinary T, S, or B code.Important: Certain AMP-defined T-, S-, or B-c...

  • Page 702

    ParamacrosChapter 2020-58Table 20.JWorksasaMacroCallCALLING PROGRAMTYPE OF MACRO NESTED 1G65,G66,orG66.1AMP-GAMP-MAMP-TSorBG65, G66 or G66.1YesYesYesYesAMP G-codeYesNoYesYesAMP M-codeYesYesNoNoAMP T-, S-, or B-codeYesyesNoNo1 What Yes/No means:Yes -- the macro type across the top row can be calle...

  • Page 703

    ParamacrosChapter 2020-59The rule to follow for Table 20.K is that an AMP-assigned macrocannot call an AMP-assigned macro.For example, if the calling program is an AMP-assigned M-codemacro, then G65, G66 and G66.1 macro calls are allowed, but noother types of macro calls are allowed, including an...

  • Page 704

    ParamacrosChapter 2020-60BPRNTThis command initiates the outputting of a variable number of parametervalues in binary format. An end of block character is output at thecompletion of outputting all of the specified values. This command is notexecuted if the POPEN command has not been issued.The fo...

  • Page 705

    ParamacrosChapter 2020-61The output from Example 20.23 would be:COMMENT HEREX0.409 Y1638.400Z12.If the output went to a punched paper tape, it would be formatted in ISOcode.DPRNTThis command initiates the outputting of a variable number of parametervalues in decimal format. An end of block charac...

  • Page 706

    ParamacrosChapter 2020-62Example 20.25 gives an example of a DPRNT program.Example 20.25DPRNT Program Example#12=123.45678;#4=-98.7;#30=234.567POPEN;DPRNT[___________________________________________]DPRNT[COMMENT*HERE*X#12[53]*Y#4[53]*T#30[20]];DPRNT[___________________________________________]PC...

  • Page 707

    Chapter2121-1In-process DresserThis chapter describes these topics:Topic:On page:Offset Generation While Dressing21-2Activating the In-process Dresser21-4Activating the In-process Dresser21-7On-line In-process Dresser Parameters21-8Calibrating the In-process Dresser21-12In this chapter, we cover ...

  • Page 708

    In-process DresserChapter 2121-2Important: The in-process dresser feature requires that your control beconfigured such that the S word controls the grinding speed. Forcylindrical grinders, this means you must be capable of performing CSS onthe grinding wheel, not the part spindle. See spindle spe...

  • Page 709

    In-process DresserChapter 2121-3In-process dresser offsets cannot be modified, activated, or deactivated bythe programmer. As long as the in-process dresser remains active, anygenerated dresser offset also remains active. Once the in-process dresser isdeactivated, the control cancels any currentl...

  • Page 710

    In-process DresserChapter 2121-4As the grinding wheel is dressed, the in-process dresser generates an offsetsimilar to a length offset. The axis (or axes) that this dresser offset isapplied to is directly dependent on the currently active plane (G17, G18, orG19) and the grinding wheel plane (defi...

  • Page 711

    In-process DresserChapter 2121-5The following discussion only applies if your system installer hasconfigured you system to leave the in-process dresser on at the end ofprogram state. If the control is in the end of program state and thein-process dresser is on, the in-process dresser offset is al...

  • Page 712

    In-process DresserChapter 2121-6When the in-process dresser is deactivated, the control will remove anyoffsets that have been generated by the in-process dresser. This can causethe wheel to lose contact with the part since the wheel diameter haschanged and the offset compensating for this change ...

  • Page 713

    In-process DresserChapter 2121-7Figure 21.3In-process dresser should compensate for either length or radiuschange (not both)Either length offset modification or entire wheeloffset modification must be performed here. Ifboth are active, the control compensates fordressing amount twice. (Either rad...

  • Page 714

    In-process DresserChapter 2121-8Dresser DisableWhen the in-process dresser is disabled, the control automatically retracts theroll away from the grinding wheel using the dresser axis. The amount thedresser is retracted is configured on the in-process dresser status page. Seepage 21-10 for informa...

  • Page 715

    In-process DresserChapter 2121-9Table 21.ADresser Parameters on the In-process Dresser ScreenThis Parameter:(paramacro system parameter)Indicates:Range:DRESSER/ACTIVE/INACTIVEif the in-process dresser is currently active (turned on) or inactive(turned off). This is controlled by PAL.Active(in-pro...

  • Page 716

    In-process DresserChapter 2121-10This Parameter:(paramacro system parameter)Range:Indicates:* DRESSER AMOUNT PER REV(paramacro #5505)the amount the dresser is to feed into the grinding wheel for eachrevolution of the grinding wheel. When the in-process dresser isactive, this amount of infeed is s...

  • Page 717

    In-process DresserChapter 2121-112.Press the {DRESSR TABLE} softkey to display the in-processdresser status screen.(softkey level 2)WORKCO-ORDWHEELGEOMETRADIUSTABLEDRESSRTABLESCALNGCOORDROTATEBACKUPOFFSETThe in-process dresser status screen appears:REPLCEVALUEADD TOVALUEINCH/METRICENTER NEW WHEEL...

  • Page 718

    In-process DresserChapter 2121-125.Replace the current value of the parameter by pressing the {REPLCEVALUE} softkey or add an amount to the current value by pressingthe {ADD TO VALUE} softkey.(softkey level 3)REPLCEVALUEADD TOVALUEINCH/METRIC6.Key in the value to replace or add to the current val...

  • Page 719

    In-process DresserChapter 2121-13The calibration operation is very PAL dependent. See the documentationprepared by your system installer for details on wheel calibration. Atypical wheel calibration routine would consist of these steps:1.Access the in-process dresser status screen and enter a new ...

  • Page 720

    In-process DresserChapter 2121-14

  • Page 721

    Chapter2222-1Program Interrupts andDressing InterruptsThis chapter describes these topics:Topic:On page:Program Interrupts22-1Enabling/Disabling Program Interrupts (M96, M97)22-2Dressing Interrupts22-10Operator Request for Dressing Interrupt22-10Auto-Dressing Request during Grinding Cycle (D Word...

  • Page 722

    Program Interrupts andDressing InterruptsChapter 2222-2Enable or disable program interrupts on the control by using two modal Mcodes. Your system installer determines in AMP these M codes. Thismanual assumes these values for these M codes (the default values in AMP):M96 Enables Program Interrupts...

  • Page 723

    Program Interrupts andDressing InterruptsChapter 2222-3Selecting the Type of Program Interrupt (L word)There are two types of interrupt programs that you can use to enable ordisable these M codes. You can use up to 4 signals from PAL (switches) tocall interrupt programs. Your system installer det...

  • Page 724

    Program Interrupts andDressing InterruptsChapter 2222-4Type 1 Program InterruptsIf no axis motion is generated by the subprogram or macro program calledby the type 1 program interrupt, the control halts program execution. Thecontrol then executes the subprogram or macro program called, returns to...

  • Page 725

    Program Interrupts andDressing InterruptsChapter 2222-5If the next un-executed part program block after the interrupt does notcontain an endpoint for all axes moved during the interrupt, the endpoint ofthe move is not the same endpoint had the interrupt not occurred. Forexample:Figure 22.1Type 1 ...

  • Page 726

    Program Interrupts andDressing InterruptsChapter 2222-6Figure 22.2Type 2 Program InterruptsProgrammed PathPath of InterruptInterruptoccursReturn pathMotions due toDelayed interrupt(3 retrace blocks)Return pathMotions due toImmediate Actioninterrupt(3 retrace blocks)Part programpath beforeinterrup...

  • Page 727

    Program Interrupts andDressing InterruptsChapter 2222-7When the return from interrupt is executed (M99 in the interrupt program),the control generates a linear move to the end-point of the last-rememberedmove for retrace. The moves are then retraced, returning the wheel back tothe start-point of ...

  • Page 728

    Program Interrupts andDressing InterruptsChapter 2222-8Selecting an Interrupt Program (P word)You can select any legal subprogram or paramacro as a program interruptprogram (see chapter 10 on subprograms or chapter 20 on paramacros). Touse a program as an interrupt program, it must have a program...

  • Page 729

    Program Interrupts andDressing InterruptsChapter 2222-9Example 22.1Enabling and Disabling the Interrupt FeaturesN1M96L0P11111;Enables program O11111 as a type 1 interrupt and allows it to beexecuted when the interrupt signal from switch 0 is received.N2M96L1P12345;Enables program O12345 as a type...

  • Page 730

    Program Interrupts andDressing InterruptsChapter 2222-10Use dressing interrupts to temporarily halt reciprocation or a grindingcycle and execute a subprogram or paramacro call. This feature allows theoperator/programmer to interrupt a reciprocating grinding operation orgrinding cycle with a wheel...

  • Page 731

    Program Interrupts andDressing InterruptsChapter 2222-11In addition to auto-dress as described on page 22-10, grinding cycles forboth cylindrical and surface grinders can be defined to have a pre-dressfeature (identified by the decimal point following the cycle G code, i.e.G8n.1). Grinding cycles...

  • Page 732

    Program Interrupts andDressing InterruptsChapter 2222-12Figure 22.3Dressing InterruptsPartReciprocationStartCycleOperator requests dressinginterrupt hereTwoblocksrememberedfor retraceProgrammed cycle blocksDressing interrupt program blocksControlgeneratedblocktofirstremembered block of interrupt1...

  • Page 733

    Program Interrupts andDressing InterruptsChapter 2222-13Number of retrace blocks for dressing interruptsYou can alter the number of blocks that the control retraces when returningto the start position of the interrupt. The default number of retraced blocks is4. Alter the number of retrace blocks ...

  • Page 734

    Program Interrupts andDressing InterruptsChapter 2222-14Your system installer can determine if an interrupt program is to becalled as a paramacro or a subprogram when executed. If you call it asa paramacro, remember that this assigns a new set of local parametersfor the interrupt. If you call it ...

  • Page 735

    Program Interrupts andDressing InterruptsChapter 2222-15Consider this list when programming and executing program or dressinginterrupts:Your system installer can determine in AMP whether an interruptprogram request is recognized when an interrupt switch is turned on, oronly when the switch makes ...

  • Page 736

    Program Interrupts andDressing InterruptsChapter 2222-16If an interrupt occurs during a block retrace, the interrupt is performed.The block retrace is aborted at that point and no further retrace isallowed. Block retrace still returns any moves that have already beenretraced before the interrupt ...

  • Page 737

    AppendixAA-1Softkey TreeThis appendix explains softkeys and includes maps of the softkey trees.We use the term softkey to describe the row of 7 keys at the bottom of theCRT. The function of each softkey is displayed on the CRT directly abovethe softkey. Softkey names are shown in this manual betw...

  • Page 738

    Softkey TreeAppendix AA-2For example :(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTWhen softkey level 1 is reached, the previous set of softkeys is displayed.Press the continue softkey {⇒} to display the remaining softkey functionson softkey level 1.(softkey level 1)FRON...

  • Page 739

    Softkey TreeAppendix AA-3(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTFRONTPANELERRORMESAGEPASS-WORDSWITCHLANGIf you want to:Press:Edit, activate, or copy a program from a peripheral or control memory{PRGRAM MANAGE}Display or enter tool offset data, the work coordinate sys...

  • Page 740

    Softkey TreeAppendix AA-4PRGRAMABSTARGETDTGAXISSELECTM CODESTATUSPRGRAMALLDTGAXIS POSITION DISPLAY FORMAT SOFTKEYSG CODESTATUSSPLITON/OFFNOTE: The first 4 softkeys (from PRGRAM to DTG) toggle between smalland large screen display.

  • Page 741

    Softkey TreeAppendix AA-5see page A-14see page A-13WITH POWER UP (AXIS POSITION) DISPLAY SCREENPRGRAMMANAGEOFFSETMACROPARAMPRGRAMCHECKSYSTEMSUPORTFRONTPANELERRORPASS-WORDSWITCHLANGMESAGETHE FUNCTION SELECT SOFTKEYS LEVEL 1PAL Display Page Option: Five softkeys available on thirdscreen. Five addit...

  • Page 742

    Softkey TreeAppendix AA-6level 1level 2level 3level 4PRGRAMMANAGEACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMVERIFYPRGRAMPRGRAMCOMENTDELETEPRGRAMRENAMEPRGRAMINPUT.DEVICEREFORMMEMORYEXECQUITEXITMEM TOPORT APORT BFROM ATO MEMMEM TOFROM BTO MEMMEM TOMEMVERIFYPORT AVERIFYPORT BVERIFYMEMOR...

  • Page 743

    Softkey TreeAppendix AA-7OFFSET (Lathe & Mill)level 1level 2level 3level 4level 5OFFSETWORKCO-ORDWEARTOOLTOOLGEOMETTOOLMANAGERANDOMCOORDROTATEBACKUPOFFSETREPLCEVALUEADD TOVALUEINCH/METRICRADI/DIAMSEARCHNUMBERREPLCEVALUEADD TOVALUEACTIVEOFFSETMORE.OFFSETMEAS-UREINCH/METRICRADI/DIAMTOOLDIRTOOLD...

  • Page 744

    Softkey TreeAppendix AA-8OFFSET (Grinder)level 1level 2level 3level 4level 5OFFSETWORKCO-ORDGEOMWHEELRADIUSTABLEDRESSERTABLECOORDROTATEBACKUPOFFSETREPLCEVALUEADD TOVALUEINCH/METRICRADI/DIAMSEARCHNUMBERREPLCEVALUEADD TOVALUECHANGEOFFSETMORE.OFFSETMEAS-UREINCH/METRICRADI/DIAMREPLACEVALUEADD TOVALUE...

  • Page 745

    Softkey TreeAppendix AA-9MACRO PARAMlevel 1level 2level 3MACROPARAMLOCALPARAMCOM-1PARAMCOM-2APARAMCOM-2BPARAMSEARCHNUMBERREFRSHSCREENSEARCHNUMBERSEARCHNUMBERREPLCEVALUEZEROVALUE0ALLVALUESREFRSHSCREEN0ALLVALUESREFRSHSCREENREPLCEVALUEZEROVALUEREPLCENAMECLEARALL NMNAMECLEARSHAREDPARAM

  • Page 746

    Softkey TreeAppendix AA-10SELECTPRGRAMQUICKCHECKSTOPCHECKGRAPHSYNTAXONLYCLEARGRAPHMACHININFOZOOMPRGRAM CHECKlevel 1level 2level 3level 4T PATHGRAPHPRGRAMCHECKWINDOWT PATHDISABLZOOMBACKGRAPHSETUPDEFALTPARAMSAVEPARAMlevel 5ACTIVEPRGRAMDE-ACTPRGRAM

  • Page 747

    Softkey TreeAppendix AA-11SUPORTSYSTEMlevel 1level 2level 3level 4level 5PRGRAMAMPDEVICEZONELIMITSF1-F9BACKUPAMPSAVECHANGEREPLCEADD TOMOREUPDATEQUITSEARCHYESNOSYSTEM SUPPORTPARAMSETUPREVERSHOMEAXISCALIBSERVOSPNDLTOTOAXISPARAMPATCHAMPUPDATEBACKUPUPLD/DWNLDCOPYDEFLTSVALUEVALUELIMITS& EXITERRORC...

  • Page 748

    Softkey TreeAppendix AA-12SUPORTSYSTEMlevel 1level 2level 3level 4level 5MONI--TIMESETDATEED PRTINFORECVSYSTEM SUPPORT (continued)PARTSPTOMSI/OEM@STARTSTOPSINGLEREPEATRINGI/OREMOTEI/OFASTI/OAXISMONITORSERIALI/OENTERMESAGESTOREBACKUPAXISPORT ARECVPORT BXMITPORT APORT BXMIT@ = AXIS NAMEXMITXMITSETT...

  • Page 749

    Softkey TreeAppendix AA-13level 1level 2level 3level 4FRONTPANELPRGRAMEXECSETZEROJOGAXES+JOGAXES--JOGAXISBLOCKRETRCEJOGRETRCTCYCLESTARTCYCLESTOPJOGJOGAXES+AXES--FRONT PANELERROR MESAGElevel 1level 2ERRORMESAGEERRORLOGCLEARACTIVEACTIVEERRORSTIMESTAMPSFULLMESAGEThis softkey toggles between [TIME ST...

  • Page 750

    Softkey TreeAppendix AA-14PASSWORDlevel 1level 2level 3UPDATE& EXIT01(NAME)02(NAME)03(NAME)04(NAME)UPDATE& EXIT05(NAME)06(NAME)07(NAME)08(NAME)STOREBACKUPACCESSCONTRLPASS-WORD(NAME) = PASSWORD NAME

  • Page 751

    Softkey TreeAppendix AA-15PRGRAMACTIVElevel 2level 3level 4level 5level 6DE-ACTPRGRAMSEARCHMID STPRGRAMT PATHGRAPHT PATHDISABLTIMEPARTSSETTIMESETDATEED PRTINFONSEARCHOSEARCHEOBSEARCHSLEWSTRINGSEARCHSEQ #SEARCHSTRINGSEARCHDEFALTPARAMSAVEPARAMFORWRDREVRSETOP OFPRGRAMCANCELEXITFORWRDREVRSETOP OFPRGR...

  • Page 752

    Softkey TreeAppendix AA-16see page A-17level 2level 3level 4level 5EDITPRGRAMMODIFYINSERTBLOCKDELETEBLOCKTRUNCDELETECH/WRDEXITEDITORSTRINGSEARCHRENUMPRGRAMMERGEPRGRAMQUICKVIEWCHAR/WORDDIGITZEFORWRDREVRSETOP OFPRGRAMBOT OFPRGRAMALLONLY NEXECLINEARCIRCLE3PNTCIRCLETANGNTMODESELECTSTOREEND PTEDIT &am...

  • Page 753

    Softkey TreeAppendix AA-17QUICK VIEWlevel 3level 4level 5level 6QUICKVIEWQPATH+PROMPTGCODEPROMTMILLPROMPTPLANESELECTSELECTSETG17G18G19STOREsee page A-18QUICKVIEWQPATH+PROMPTGCODEPROMTDRILLPROMPTPLANESELECTSELECTSETG17G18G19STORELATHEPROMPTMILLLATHE

  • Page 754

    Softkey TreeAppendix AA-18QPATH+ PROMPTlevel 4level 5level 6QPATH+CIRANG PTCIRCIRANGANGCIR PT2ANGPT2PT R2ANGPT C2ANG2PT C2PT 2R3PT2R2ANG2PT 2C3PT2C2ANG2PT RC3PT RC2ANG2PT CR3PT CRSTORE2ANGPT RPROMPTPTEND OF APPENDIX

  • Page 755

    AppendixBB-1Error and System MessagesThis appendix serves as a guide to error and system messages that canoccur during programming and operation of the 9/Series control. We listedthe messages in alphabetical order along with a brief description.Important: To display both active and inactive messa...

  • Page 756

    Error and System MessagesAppendix BB-2MessageDescription22MB RAM IS BAD/MISSINGThe control has discovered the RAM SIMMs for the two megabyte extended storage option areeither damaged or missing. The RAM SIMMs must be installed or replaced. Contact your AllenBradley sales representative for assist...

  • Page 757

    Error and System MessagesAppendix BB-3MessageDescriptionAMP WAS MODIFIED BY PATCH AMP UTILITYThis message always appears after changes have been made to AMP using the patch AMPutility. Its purpose is to remind the user that the current AMP has not been verified by across-reference check normally ...

  • Page 758

    Error and System MessagesAppendix BB-4MessageDescriptionAXIS INVALID FOR G24/G25The programmed axis was not AMPed for software velocity loop operation, and can not be usedin a G24 or G25 block. To use these features the axis programmed must be configured fortachless operation (or be a digital ser...

  • Page 759

    Error and System MessagesAppendix BB-5MessageDescriptionBAD RAM DISC SECTOR CHECKSUM ERRORA RAM disk sector error was detected during the RAM checksum test at power-up. Attempt topower-up again. If the error remains, contact Allen-Bradley customer support services.BAD RECORD IN PROGRAMThis indica...

  • Page 760

    Error and System MessagesAppendix BB-6MessageDescriptionCANNOT COPYThe requested copying task cannot be performed due to an internal problem in the file or RAMdisk. Contact Allen-Bradley customer support service.CANNOT DELETE - OPEN PROGRAMThe selected program is either active or open for editing...

  • Page 761

    Error and System MessagesAppendix BB-7MessageDescriptionCANNOT RENAMEWhen performing a rename of a program name, the new program name has not been correctlyentered. The format is OLD PROGRAM NAME,NEW PROGRAM NAME.CANNOT REPLACE START POINTAn illegal attempt was made to change the axis calibration...

  • Page 762

    Error and System MessagesAppendix BB-8MessageDescriptionCHARACTERS MUST FOLLOW WILDCARDYou have used incorrect search string syntax in the PAL search monitor utility.CHECKSUM ERROR IN FILEThe file (AMP, PAL) being downloaded from a storage device has a checksum error. The filecannot be used.CIRCL...

  • Page 763

    Error and System MessagesAppendix BB-9MessageDescriptionCPU #2 HARDWARE ERROR #4The 68030 main processor has detected an illegal address. Consult Allen-Bradley customersupport services (9/290 only).CPU #2 HARDWARE ERROR #6The 68030 main processor has detected a privilege violation. Consult Allen-...

  • Page 764

    Error and System MessagesAppendix BB-10MessageDescriptionCYLIND/VIRTUAL CONFIGURATION ERRORAn axis configuration error was detected by the control when cylindrical interpolation or end facemilling was requested in a program block. Some examples would include:A cylindrical/virtual axis is named sa...

  • Page 765

    Error and System MessagesAppendix BB-11MessageDescriptionDEPTH PROBE TRAVEL LIMITThe adaptive depth probe has moved to its AMPed travel limit. Note the value entered in AMPis the adaptive depth probe deflection from the PAL determined probe zero point. It may not bethe actual total probe deflecti...

  • Page 766

    Error and System MessagesAppendix BB-12MessageDescriptionDRESSER WARNING LIMIT REACHEDThe axis specified as the dresser axis has been dressed smaller than the dresser warning limitvalue as specified on the dresser status page.DRILL AXIS CONFIGURATION ERRORThe drilling axis is not a currently conf...

  • Page 767

    Error and System MessagesAppendix BB-13MessageDescriptionENCODER QUADRATURE FAULTAn error has been detected in the encoder feedback signals. Likely causes are excessive noise,inadequate shielding, poor grounding, or encoder hardware failure.END OF FILEWhen transferring a file over the serial port...

  • Page 768

    Error and System MessagesAppendix BB-14MessageDescriptionEXTRA KEYBOARD OR HPG ON I/O RINGThe control detected a keyboard or HPG on the 9/Series fiber optic ring that was not configuredas a ring device. The I/O ring will still function and the control will NOT be held in E-Stop. Youmay also use t...

  • Page 769

    Error and System MessagesAppendix BB-15MessageDescriptionFLASH SIMMS CONTAIN INVALID DATAFlash SIMMs have become corrupted probably from a communication error during a systemupdate. Retry the system executive update utility. If the situation persists, contactAllen--Bradley support.FLASH SIMMS U10...

  • Page 770

    Error and System MessagesAppendix BB-16MessageDescriptionGRAPHICS ACTIVE IN ANOTHER PROCESSGraphics can only be active in one process at a time. You must turn graphics off in one processbefore you can activate them in another process.HHARD STOP ACTIVATION ERRORAn attempt was made to (G24) hard st...

  • Page 771

    Error and System MessagesAppendix BB-17MessageDescriptionHIPERFACE PASSWORD FAILUREDuring the SINCOS device’s alignment procedure, the logic used to set the passwords detectsan incorrect password. A section of the code will repeatedly attempt various combinations ofeach of the passwords to corr...

  • Page 772

    Error and System MessagesAppendix BB-18MessageDescriptionILLEGAL DUAL CONFIGURATIONBoth dual master axes names have the same letter OR when assigning dual groups in AMP,dual groups must be assigned in contiguous order, starting with group 1, 2, 3, 4, and 5. You cannot assign axes to dual group 3 ...

  • Page 773

    Error and System MessagesAppendix BB-19MessageDescriptionINCOMPATIBLE TOOL ACTIVATION MODESThis message is displayed and the control is held in E-Stop at power up when the tool geometryoffset mode is “Immediate Shift/Immediate Move” and the tool wear offset mode is “ImmediateShift/Delay Mov...

  • Page 774

    Error and System MessagesAppendix BB-20MessageDescriptionINVALID CHECKSUM DETECTEDThis error is common for several different situations. Most typically it results when writing orrestoring invalid data to flash memory. For example if axis calibration data is being restored toflash and there was an...

  • Page 775

    Error and System MessagesAppendix BB-21MessageDescriptionINVALID FIXED DRILLING AXISThe axis selected as the drilling axis is an invalid axis for a drilling application.INVALID FORMAT SPECIFIED IN B/DPRNT CMDImproper format was used in the paramacro command (BPRNT or DPRNT) that outputs data toa ...

  • Page 776

    Error and System MessagesAppendix BB-22MessageDescriptionINVALID PROGRAM NUMBER (P)A program number called by a sub-program or paramacro call is invalid. A P-word that calls asub-program or paramacro can only be an all-numeric program name as many as 5 digits long.The O-word preceding the numeric...

  • Page 777

    Error and System MessagesAppendix BB-23MessageDescriptionINVALID TOOL LENGTH OFFSET NUMBERAn attempt was made to enter a tool length offset number in the tool life management table thatis larger than the maximum offset number allowed. If the tables are being loaded by a G10program, the length off...

  • Page 778

    Error and System MessagesAppendix BB-24MessageDescriptionLARGER MEMORY - REFORMATThis message typically occurs after a new AMP or PAL has just been downloaded to the control.There is now more memory available for the RAM disk, but you need to reformat to use it. Ifdesired, you do not have to refo...

  • Page 779

    Error and System MessagesAppendix BB-25MessageDescriptionMAXIMUM BLOCK NUMBER REACHEDA renumber operation was performed to renumber block sequence numbers (N-words), and thecontrol has exceeded a block number of N99999. Either the program is too large to renumber,or the parameters for the first s...

  • Page 780

    Error and System MessagesAppendix BB-26MessageDescriptionMINIMUM RPM LIMIT AUXILIARY SPINDLE 2The commanded aux spindle 2 speed requested by the control is less than the AMPed minimumaux spindle 2 speed for the current gear being used. This requires a gear change operation or achange in the progr...

  • Page 781

    Error and System MessagesAppendix BB-27MessageDescriptionMISSING I/O RING DEVICEThe I/O assignment file that was compiled and downloaded with PAL defines an I/O ring devicethat is not physically present in the I/O ring. Verify that all device address settings are correct.MISSING INTEGRAND/RADIUS ...

  • Page 782

    Error and System MessagesAppendix BB-28MessageDescriptionMULTIPLE FUNCTIONS NOT ALLOWEDMultiple functions are not allowed.MULTIPLE SPINDLE CONFIGURATION ERROREach multiple spindle must have a servo board identified in AMP to indicate to which board thespindle is connected. The spindle must be inc...

  • Page 783

    Error and System MessagesAppendix BB-29MessageDescriptionNNEED SHADOW RAM FOR ONLINE SEARCHYour system contains the DH+ module and you have not installed the extra RAM SIMMS thatare required to run the PAL online search monitor with the DH+ module installed. You must buyadditional RAM for a syste...

  • Page 784

    Error and System MessagesAppendix BB-30MessageDescriptionNO PROGRAM TO RESTARTThere is no program to restart. The previous program was either completed or cancelled.NO RECIPROCATION DISTANCEA reciprocation interval of zero (0) was programmed for a grinder reciprocation fixed cycle.NO RECIPROCATIO...

  • Page 785

    Error and System MessagesAppendix BB-31MessageDescriptionOOBJECT NOT FOUND IN PROGRAMThe object you are searching for in the search monitor utility does not exist in the currentmodule, or does not exist in the program in the direction you are searching.OCI ETHERNET CARD NOT INSTALLEDAn OCI dual--...

  • Page 786

    Error and System MessagesAppendix BB-32MessageDescriptionOVER SPEED IN POCKET CYCLEThe programmed feedrate for an irregular pocket cycle (G89) was too high for the cycle to keepup. The part program stops at the endpoint of the block in which the error occurred. The cyclemust be executed with a lo...

  • Page 787

    Error and System MessagesAppendix BB-33MessageDescriptionPAL SOURCE REV. MISMATCH -- CAN’T MONITORPAL source code in the control does not match the revision of the CNC executive. The PALcode may execute if all of the PAL system flags exist but the monitor cannot be used.PAL USING MEMORY - REFOR...

  • Page 788

    Error and System MessagesAppendix BB-34MessageDescriptionPOCKET IS PART OF CUSTOM TOOLAn attempt was made to assign a tool to a tool pocket that is already used by a custom tool.Custom tools are assigned to tool pockets that are shown with an XXXX next to the pocketnumber on the random tool table...

  • Page 789

    Error and System MessagesAppendix BB-35MessageDescriptionPROGRAM NOT FOUNDThe program cannot be located in memory. Check to make sure the program name wascorrectly entered.PROGRAM OPEN FOR EDIT IN ANOTHER PROCESSOn a dual-processing system, you cannot edit a program that is active in another proc...

  • Page 790

    Error and System MessagesAppendix BB-36MessageDescriptionRECIP AXIS IN WRONG PLANEThe reciprocation axis specified in a G81 or a G81.1 programming block is not in the currentlyselected plane.RECIP AXIS NOT PROGRAMMEDNo reciprocation axis was specified in a G81 or a G81.1 programming block.RECIPRO...

  • Page 791

    Error and System MessagesAppendix BB-37MessageDescriptionREMOTE I/O USER FAULT OCCURREDThe RIO module detected that the user fault bit was set. The interboard communications faultLED is flashing.REMOTE I/O WATCHDOG TIMEOUTThe watchdog mechanism on the RIO module timed out, indicating that the RIO...

  • Page 792

    Error and System MessagesAppendix BB-38MessageDescriptionS--CURVE OPTION NOT INSTALLEDAn attempt was made to select S--Curve Acc/Dec (G47.1) when the S--Curve option bit was setto false. Make sure your system includes the S--Curve option.S NOT LEGAL PROGRAMMING AXIS NAMEThis is displayed at power...

  • Page 793

    Error and System MessagesAppendix BB-39MessageDescriptionSERVO AMP C LOOP GAIN ERROROne of the following AMP parameter errors exist::Current Prop. Gain + Current Integral Gain < 4096orCurrent Prop. Gain - Current Integral Gain > 0.SERVO AMP ERRORThere is an error in one or more of the AMP p...

  • Page 794

    Error and System MessagesAppendix BB-40MessageDescriptionSERVO PROCESSOR OVERLAPThe analog version of the servo sub-system provides fine iteration overlap detection. Thismessage is displayed if the fine iteration software on the DSP does not execute to completion inone fine iteration.SERVO PROM C...

  • Page 795

    Error and System MessagesAppendix BB-41MessageDescriptionSPINDLE IS CLAMPEDAn attempt was made to program a block containing a spindle code other than an M05 while thePAL servo clamp request flag for the spindle was set.SPINDLE MODES INCOMPATIBLEAn attempt was made to enter virtual mode when the ...

  • Page 796

    Error and System MessagesAppendix BB-42MessageDescriptionSYSTEM MODULE GROUND FAULTThe 1394 system module has detected a ground fault. The system generates a ground faultwhen there is an imbalance in the DC bus of greater than 5A. This drive error can be caused byincorrect wiring (verify motor an...

  • Page 797

    Error and System MessagesAppendix BB-43MessageDescriptionTHREAD LEAD IS ZERONo thread lead has been programmed in a block that calls for thread cutting. Thread lead isprogrammed with either an F- or an E-word.THREAD PULLOUT DISTANCE TOO LARGEThe programmed threading pullout distance is larger tha...

  • Page 798

    Error and System MessagesAppendix BB-44MessageDescriptionTOO MANY NONMOTION CHAMFER/RADIUS BLOCKSToo many non-motion blocks separate the first tool path that determines the chamfer or radiussize (programmed with a ,R or ,C) from the second tool path. A maximum number ofnon-motion blocks is set in...

  • Page 799

    Error and System MessagesAppendix BB-45MessageDescriptionUNABLE TO SYNCH IN CURRENT MODEThe control can not perform the request to synchronize spindles. Possible causes are:synchronization is already active; virtual/cylindrical programming or a threading operation isactive on the primary or follo...

  • Page 800

    Error and System MessagesAppendix BB-46MessageDescriptionZZ-WORD CANNOT BE GREATER THAN R-WORDThe depth (Z-word) of a pocket formed using a G88.5 and G88.6 hemispherical pocket cyclecannot be greater than the radius (R-word) of that pocket.ZONE 2 PROGRAM ERRORThe next block in the program or MDI ...

  • Page 801

    AppendixCC-1G-Code TableThis appendix lists the G--codes for the 9/Series surface and cylindricalgrinder. This table is presented numerically by G--code along with a briefdescription of their use. These G--codes are described in detail within thismanual.The group number given in the table refers ...

  • Page 802

    G-Code TableAppendix CC-2SurfaceGrinderModal orNon-modalFunctionGroupNumberCylindricalGrinderG12.3G12.3Spindle 3 ControllingG13G1300QuickPath Plus use first intersectionNon-modalG13.1G13.1QuickPath Plus use second intersectionG14G1419Disable ScalingModalG14.1G14.1Enable ScalingG17G1702Axis plane ...

  • Page 803

    G-Code TableAppendix CC-3SurfaceGrinderCylindricalGrinderGroupNumberFunctionModal orNon-modalG47G4724Linear Acc/Dec in All ModesModalG47.1G47.1S--Curve Acc/Dec for Positioning and Exact Stop ModeG47.9G47.9Infinite Acc/Dec (No Acc/Dec) (AMP--selectable only)G48G4800Reset Acc/Dec to Default AMPed V...

  • Page 804

    G-Code TableAppendix CC-4SurfaceGrinderCylindricalGrinderGroupNumberFunctionModal orNon-modalG82.1Plunge grind with predress-- --G82.1Incremental face grind with predress, axis 1 plungeG83-- --Incremental plane grind, axis 1 plunge-- --G83Incremental plunge grind, axis 2 plungeG83.1-- --Increment...

  • Page 805

    9/Series GrinderIndexOperation and Programming ManualiNumbers1771-SB Cartridge, 9-4AA Word, 10-21Absolute Coordinates, 11-2Absolute Mode, 11-44Absolute Position Display, 8-6Acceleration/Deceleration, 12-63for short blocks, 12-75Access Control, 2-23assigning access levels and passwords, 2-24protec...

  • Page 806

    9/Series GrinderIndexOperation and Programming ManualiiChanging and Inserting, 5-7Changing Languages, 8-23Changing ParametersAuto Erase, 8-32Auto Size, 8-30Grid Lines, 8-30Overtravel Zone Lines, 8-30Process Speed, 8-32Rapid Traverse, 8-29Select Graph, 8-29Sequence Starting #:, 8-31Sequence Stoppi...

  • Page 807

    9/Series GrinderIndexOperation and Programming ManualiiiDD Word, 22-10Date, setting, 2-44Deceleration, 12-63Decitek AB 8000-XPDR, 9-4Deleting a Program, 5-37Determining the wheel angle, 14-2Diameter Mode (G08), 11-46Digitizing a Program, 5-28arc (3 points), 5-33arc tangent at end points, 5-35line...

  • Page 808

    9/Series GrinderIndexOperation and Programming ManualivD word, 22-10during compensation, 22-15execution of, 22-11M900M904, 22-13making request, 22-10operator request (manual type), 22-10overview, 22-1, 22-10pre dress request, 22-11program requirements, 22-13retrace blocks, 22-13selecting program,...

  • Page 809

    9/Series GrinderIndexOperation and Programming ManualvGG Code Format Prompting, 5-23G Code Status, 8-20G Code Table, 10-25G CodesG00, 12-2G01, 12-3G02, 12-5G03, 12-5G04, 12-78G07, 11-46G08, 11-46G09, 12-69G10, 11-8, 11-11, 13-5G10L10, 13-5G10L2, 10-25, 11-8G12.1, 12-71G12.2, 12-71G12.3, 12-71G13,...

  • Page 810

    9/Series GrinderIndexOperation and Programming ManualviG86.1 (cyl. grind.), 17-26G86.1 (surf. grind.), 16-23G87 (cyl. grind.), 17-28, 17-32G87.1 (cyl. grind.), 17-28, 17-32G88 (cyl. grind.), 17-30G88.1 (cyl. grind.), 17-30, 17-31G89, 17-32G89.1, 17-32G90, 11-44G91, 11-44G92, 11-14G92.1, 11-20G92....

  • Page 811

    9/Series GrinderIndexOperation and Programming Manualviiprogram, 22-13request, 22-15Italian, Language Display, 8-23JJapanese, Language Display, 8-23Jogonthe fly, 4-6Jog Retract, 2-10, 7-27Jog Select, 2-9Joggingarbitrary angle jog, 4-5continuous jog, 4-3HPG jog, 4-4incremental jog, 4-3jogging an a...

  • Page 812

    9/Series GrinderIndexOperation and Programming Manualviiimanual mode, on angled-wheel grinders, 14-14Manual Operating Mode, 4-1max cutting feedrate, on angled wheel grinder, 14-7Maximum Baud Rate, Setup, 9-5Maximum Wheel Speed (RPM), 21-9MDI Mode, 4-13operation, 4-14Mechanical Handle Feed, 4-10Me...

  • Page 813

    9/Series GrinderIndexOperation and Programming ManualixAMP Defined, G Macro Call, 20-6block look ahead, 15-59Local Parameters Assignments, 20-13macro callAMP defined G, 20-54AMP defined M, 20-55AMP defined T, S, and B, 20-56cancel modal (G67), 20-50modal paramacro call (G66.1), 20-52modal paramac...

  • Page 814

    9/Series GrinderIndexOperation and Programming ManualxProgram Position Display, 8-3Program Search, {SEARCH}, 7-10Programmable Acc/Dec, 12-67Programmable Zones, 3-25, 11-34, 11-35on an angled-wheel grinder, 14-17zone 2, 11-35, 11-38zone 3, 11-35, 11-40Programming Configuration, 10-6PromptingGCodes...

  • Page 815

    9/Series GrinderIndexOperation and Programming ManualxiSelecting a Part Program Input Device, 7-5Selecting Linear Acc/Dec Modes, Using G47, 12-67Selecting Linear Acc/Dec Values, Using G48, 12-68Sequence Numbers, 5-13, 10-9, 10-34Sequence Stop, {SEQ STOP}, 7-2Serial Ports, 9-3Servo Off, 4-10Short ...

  • Page 816

    9/Series GrinderIndexOperation and Programming ManualxiiOUTPUT ALL, 9-15PASSWORD, 2-24, 2-30, 2-31PLANE SELECT, 5-27, 5-30, 11-33PRGRAM,8-1,8-3PRGRAM CHECK, 8-24PRGRAM COMENT, 5-40PRGRAM DTG, 8-17PRGRAM EXEC, 2-16PRGRAM MANAGE, 2-42, 2-44, 5-2, 5-37, 5-38,5-39, 5-40, 5-41, 5-43, 7-3, 7-5, 7-6, 7-...

  • Page 817

    9/Series GrinderIndexOperation and Programming ManualxiiiSystem Timing Screen, 8-37TT Word, 10-36, 13-1programming, 13-2Tape Format, 10-2Tape PunchDSI SP75, 9-4Facit 4070, 9-4Facit N4000, 9-4Tape Punches, 9-13Tape ReaderDecitek AB 8000---XPDR, 9-4Facit N4000, 9-4Ricoh PTR240, 9-4Tape Readers, 9-9...

  • Page 818

    9/Series GrinderIndexOperation and Programming Manualxiv

  • Page 819

  • Page 820

x