Navigation

  • Page 1

    Operation andProgrammingManual9/Series CNCLatheAllen-Bradley

  • Page 2

    Because of the variety of uses for the products described in this publication,those responsible for the application and use of this control equipment mustsatisfy themselves that all necessary steps have been taken to assure thateach application and use meets all performance and safety requirement...

  • Page 3

    9/Series LatheOperation and Programming ManualOctober 2000Summary of ChangesThe following is a list of the larger changes made to this manual since itslast printing. Other less significant changes were also made throughout.Error Message LogParamacro ParametersSoftkey TreeError MessagesWe use revi...

  • Page 4

    Chapter

  • Page 5

    9/Series PAL Reference ManualIndex (General)9/Series LatheTable of ContentsOperation and Programming ManualiChapter 1Using This Manual1.0 Chapter Overview1-1. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1.1 Audience1-1. ...

  • Page 6

    9/Series PAL Reference ManualIndex (General)9/Series LatheTable of ContentsOperation and Programming Manualii3.1.3 Setting Tool Offset Tables3-8. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3.1.4 Setting Offset Data Using {MEASURE}3-11. ....

  • Page 7

    9/Series PAL Reference ManualIndex (General)9/Series LatheTable of ContentsOperation and Programming Manualiii5.3.5 Selecting a QuickView Plane5-27. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .5.4 Digitizing a Program (Teach)5-28. . . . . . ....

  • Page 8

    9/Series PAL Reference ManualIndex (General)9/Series LatheTable of ContentsOperation and Programming ManualivChapter 8Display and Graphics8.0 Chapter Overview8-1. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .8.1 Selection...

  • Page 9

    9/Series PAL Reference ManualIndex (General)9/Series LatheTable of ContentsOperation and Programming Manualv10.4.1 Leading Zero and Trailing Zero Suppression10-16. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .10.4.2 Programming without Numeric Values10-18. . . . . . ...

  • Page 10

    9/Series PAL Reference ManualIndex (General)9/Series LatheTable of ContentsOperation and Programming ManualviChapter 13Coordinate Control13.0 Chapter Overview13-1. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .13.1 Plane Sel...

  • Page 11

    9/Series PAL Reference ManualIndex (General)9/Series LatheTable of ContentsOperation and Programming Manualvii16.2 Corner Radius16-4. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .16.3 Considerations with Chamfering an...

  • Page 12

    9/Series PAL Reference ManualIndex (General)9/Series LatheTable of ContentsOperation and Programming Manualviii19.1 Parking a Dual Axis19-3. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .19.2 Homing a Dual Axis19-4. . . . . . ...

  • Page 13

    9/Series PAL Reference ManualIndex (General)9/Series LatheTable of ContentsOperation and Programming ManualixChapter 22Single-Pass Turning Cycles22.0 Chapter Overview22-1. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .22.1 S...

  • Page 14

    9/Series PAL Reference ManualIndex (General)9/Series LatheTable of ContentsOperation and Programming Manualx(G84.2): Right-Hand Solid-Tapping Cycle26-20. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .(G84.3): Left-Hand Solid-Tapping Cycle26-23. . . . . . ....

  • Page 15

    9/Series PAL Reference ManualIndex (General)9/Series LatheTable of ContentsOperation and Programming ManualxiChapter 29Program Interrupt29.0 Chapter Overview29-1. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .29.1 Enabling a...

  • Page 16

    9/Series PAL Reference ManualIndex (General)9/Series LatheTable of ContentsOperation and Programming ManualxiiG-code Compatibility ConsiderationsD-1. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .M-code Compatibility ConsiderationsD-7. . . . ...

  • Page 17

    Chapter11-1Using This ManualThis chapter describes how to use this manual. Major topics include:TopicOn page:Manual organization1-1Reading this manual1-3Terms and conventions1-4Related publications1-5We intend the audience for this manual to be people who program and/oroperate an Allen-Bradley 9/...

  • Page 18

    Manual/MDI Operation ModesChapter 11-2Table 1.AManual OrganizationChapterTitleSummary1Manual OverviewManual overview, intended audience, definition of key terms, how to proceed.2Basic Control OperationA brief description of the control’s basic operation including power up, MTB panel, operator p...

  • Page 19

    Manual/MDI Operation ModesChapter 11-330Using a 9/Series Dual--ProcessingSystemDescribes dual--process system. Includes synchronizing multiple part programs and shared spindleconfigurations.Table 1.A (continued)Manual OrganizationAppendixTitleSummaryAppendix A Softkey TreeDescribes softkeys and t...

  • Page 20

    Manual/MDI Operation ModesChapter 11-4Explanations and illustrations are presented based on the movement ofthe cutting tool on a fixed workpiece.The 9/Series control lets you use any alphabetic character for expressinga numerically controlled axis. This manual uses X and Z for the firstand second...

  • Page 21

    Manual/MDI Operation ModesChapter 11-5HPGHand Pulse GeneratorI/OInput/OutputMDIManual Data InputModalan operating condition that remains in effect on the control until cancelledor replacedMTBMachine Tool BuilderODSOffline Development SystemPALProgrammable Application LogicRAMRandom Access Memory ...

  • Page 22

    Manual/MDI Operation ModesChapter 11-6

  • Page 23

    Chapter22-1Basic Control OperationThis chapter describes how to operate the Allen-Bradley 9/Series control,including:Topic:On page:MTB panel2-10{FRONT PANEL}2-13Power-up2-21Emergency stops2-22Access control2-23Changing modes2-30Display system and messages2-34Input cursor2-37{REFORM MEMORY}2-38Rem...

  • Page 24

    Basic Control OperationChapter 22-2Figure 2.1Monochrome Operator PanelTRANSMITSHIFT789ONGP456XYZQ123IJKR_0.ABCL+=:FDHEOBMST#CALC DEL CAN RES;%E?.()[]9/SERIESoSP19435PROCDISP_*!$Figure 2.2Color Operator Panel789+456_123=.0:CALCDISP PROCTRANSMITRESCNTRLCANDELLINEEOB)TCH#,L&SPC(D?BS]FEAM[SHIFTGZ...

  • Page 25

    Basic Control OperationChapter 22-3Table 2.A explains the functions of keys on the operator panel keyboard.In this manual, the names of operator panel keys appear between [ ]symbols.Table 2.AKey FunctionsKey NameFunctionAddress and Numeric KeysUse these keys to enter alphabetic and numericcharact...

  • Page 26

    Basic Control OperationChapter 22-4Reset OperationsIf you are using a dual-processing system, refer to page 30-6 for detailsabout reset operations.Block ResetUse the block reset feature to force the control to skip the block execution.To use the block reset function, program execution must be sto...

  • Page 27

    Basic Control OperationChapter 22-5Expressions entered on the input line cannot exceed a total of 25characters. Only numeric or special mathematical operation characters asdescribed below can be entered next to the “CALC:” prompt. Anycharacter that is not numeric or an operation character you...

  • Page 28

    Basic Control OperationChapter 22-6Example 2.1Mathematic ExpressionsExpression EnteredResult Displayed12/4*3912/[4*3]112+2/213[12+2]/2712-4+31112-[4+3]5Table 2.C lists the function commands available with the [CALC]key.Table 2.CMathematical FunctionsFunctionMeaningSINSine (degrees)COSCosine (degr...

  • Page 29

    Basic Control OperationChapter 22-7Example 2.2Format for [CALC]FunctionsSIN[2]This evaluates the sine of 2 degrees.SQRT[14+2]This evaluates the square root of 16.SIN[SQRT[14+2]]This evaluates the sine of the square root of 16.Example 2.3Mathematical Function ExamplesExpression EnteredResultSIN[90...

  • Page 30

    Basic Control OperationChapter 22-8Example 2.4Calling Paramacro Variables with the CALC FunctionExpression EnteredResult Displayed#100Display current value of variable #10012/#100*3Divide 12 by the current value of #100and multiply by 3SIN[#31*3]Multiply the value of #31 (for the currentlocal par...

  • Page 31

    Basic Control OperationChapter 22-9Softkey level 1 is the initial softkey level the control displays at power-up.Softkey level 1 always remains the same and all other levels are referencedfrom softkey level 1.The softkeys on opposite ends of the softkey row have a specific use thatremains standar...

  • Page 32

    Basic Control OperationChapter 22-10To use a softkey function, press the plain, unmarked button directly belowthe description of the softkey function.Important: Some of the softkey functions are purchased as optionalfeatures. This manual assumes that all available optional features havebeen purch...

  • Page 33

    Basic Control OperationChapter 22-11If you are using a dual-operating system, your MTB panel may operatedifferently than described here. Refer to page 30-11 for information aboutyour MTB panel.Figure 2.4Push-Button MTB Panel19930JOG SELECTSPINDLE SPEEDOVERRIDESPINDLEMODE SELECTSPEED/MULTIPLYRAPID...

  • Page 34

    Basic Control OperationChapter 22-12Table 2.DFunctions of the Buttons on the Push-Button MTB PanelSwitch or Button NameHow It Works= Default for Push-Button MTB PanelMODE SELECTSelects the operation modeAUTO ---- automatic modeMANUAL ---- manual modeMDI ---- manual data input modeJOG SELECTSelect...

  • Page 35

    Basic Control OperationChapter 22-13Table 2.D (continued)Functions of the Buttons on the Push-Button MTB PanelSwitch or Button Name= Default for Push-Button MTB PanelHow It WorksCYCLE STOPThe control stops part program execution, MDI execution, or program check when this button ispressed. If pres...

  • Page 36

    Basic Control OperationChapter 22-14The software MTB panel can control these features:FeatureDescriptionMode SelectSelect either Automatic, MDI, or Manual modes as the current operating mode of the control.Rapid TraverseThis feature replaces the feedrate when executing a continuous jog move with ...

  • Page 37

    Basic Control OperationChapter 22-15Software MTB Panel ScreenTo use the software MTB panel feature, follow these steps:1.From the main menu screen, press the {FRONT PANEL}softkey.(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTFRONTPANELERRORMESAGEPASS-WORDSWITCHLANGThe Softw...

  • Page 38

    Basic Control OperationChapter 22-16Jog ScreenWe assumes that you have performed the steps to display the SoftwareFront Panel screen. Make sure that the function selected on the SoftwareFront Panel screen is not the Mirror Image or the Axis Inhibit features.1.Press the {JOG AXIS}softkey.(softkey ...

  • Page 39

    Basic Control OperationChapter 22-17Program Execute ScreenThe following assumes that the steps have been performed to display theSoftware Front Panel screen (see page 2-15). Make sure that the functionselected on the Software Front Panel screen is not the Mirror Image northe Axis Inhibit feature....

  • Page 40

    Basic Control OperationChapter 22-182.Select one of these softkey options:block retracejog retractcycle startcycle stopTo Perform a: Press:Cycle Startthe softkey that corresponds to the desired feature. Details on thesefeatures are described in chapter 7.Cycle Stopthe softkey that corresponds to ...

  • Page 41

    Basic Control OperationChapter 22-19Figure 2.5Jog Retract Software MTB Panel ScreenJOGAXES+JOGAXES-E-STOPPROGRAM[ MM]F00000.000 MMPMZ00000.000S0R X00000.000T12C359.99FILENAMESUB NAMEMEMORYMANSTOPThe basic procedure for turning power on and off is described in thissection. Refer to the documentati...

  • Page 42

    Basic Control OperationChapter 22-20After power has been turned on, the control displays the power turn-onscreen. To activate the main menu, press the [TRANSMIT]key.You see the main menu screen:PROGRAM[ MM]F00000.000 MMPMZ00000.000SR X00000.000T12345C359.99FILENAMESUB NAME 9999MEMORY 30000 MDISTO...

  • Page 43

    Basic Control OperationChapter 22-21After powering up the control or performing a control reset operation (seepage 2-4), the control assumes a number of initial operating conditions.These are listed below:Initial Password Access is assigned to the level that was active whenpower was turned off (p...

  • Page 44

    Basic Control OperationChapter 22-22Press the red <EMERGENCY STOP>button on the MTB panel (or any otherE-stop switches installed on the machine) to stop operations regardless ofthe condition of the control and the machine.WARNING: To avoid damage to equipment or hazard topersonnel, the syst...

  • Page 45

    Basic Control OperationChapter 22-23If the E-Stop occurred during program execution, the control may reset theprogram when E-Stop reset is performed provided AMP is configured todo so. Assuming that a control reset is performed, program executionbegins from the first block of the program when <...

  • Page 46

    Basic Control OperationChapter 22-24This section describes setting or changing the functions assigned to aparticular access level, and changing the password used to activate thataccess level.Important: Functions or passwords can be assigned to another accesslevel only if:If you have a higher acce...

  • Page 47

    Basic Control OperationChapter 22-252.Press the {ACCESS CONTRL}softkey. If the {ACCESS CONTRL}softkey does not appear on the screen, the currently active accesslevel is not allowed to use the {ACCESS CONTRL}function. Enter apassword that has access to {ACCESS CONTRL}.(softkey level 2)ACCESSCONTRL...

  • Page 48

    Basic Control OperationChapter 22-263.Press the softkey that corresponds to the access level that you want tochange. The pressed softkey appears in reverse video, and thepassword name assigned to that access level is moved to the“PASSWORD NAME.”Important: If you attempt to change the function...

  • Page 49

    Basic Control OperationChapter 22-27The following section describes the functions on the 9/Series control thatcan be protected from an operator by the use of a password. If a user hasaccess to a function, the parameter associated with that function is shownin reverse video on the access control s...

  • Page 50

    Basic Control OperationChapter 22-28Table 2.E (continued)Password Protectable FunctionsParameter Name:Function becomes accessible when parameter name is in reverse video:8) OFFSETS·{WORK CO-ORD}— Display and alter the preset work coordinate system zero locations and thefixture offset value.·{...

  • Page 51

    Basic Control OperationChapter 22-29Table 2.E (continued)Password Protectable FunctionsParameter Name:Function becomes accessible when parameter name is in reverse video:22) SI/OEM MESSAGE·{ENTER MESSAGE}— Enter a new message to be displayed on the control’s power-up screen.·{STORE BACKUP}...

  • Page 52

    Basic Control OperationChapter 22-30ACCESSCONTRLENTER PASSWORD:PROGRAM [INCH]F0.000 MMPMZ00000.000S0R X00000.000T1C359.99MEMORYMANSTOPE-STOP2.Enter the password you want to activate by typing it in on the inputline with the keys on the operator panel. The control displays * forthe characters you ...

  • Page 53

    Basic Control OperationChapter 22-31The control is executing a threading- or multiple-pass turning cycle.Important: Your system installer may have written PAL to disable the useof the {FRONT PANEL}softkey to change modes. If this is the case, thenchanging modes can be performed by using only <...

  • Page 54

    Basic Control OperationChapter 22-32MDI modeTo operate the machine in MDI mode,select MDI under <MODE SELECT>orpress the {FRONT PANEL}softkeyUse left/right arrow keys to change mode select options if using{FRONT PANEL}.For details on MDI operation, see page 4-11.Figure 2.7MDI Mode ScreenMDI...

  • Page 55

    Basic Control OperationChapter 22-33Automatic modeTo operate the machine automatically,select AUTO under <MODE SELECT>orpress the {FRONT PANEL}softkeyUse left/right arrow keys to select mode options if using {FRONT PANEL}.For details on automatic operation, see chapter 7.Figure 2.8Automatic...

  • Page 56

    Basic Control OperationChapter 22-34The control has two screens dedicated to displaying messages. TheMESSAGE ACTIVE screen displays up to nine of the most currentsystem messages and ten of the most current machine (logic generated)messages at a time. The MESSAGE LOG screen displays a log of up to...

  • Page 57

    Basic Control OperationChapter 22-35Figure 2.9Message Active Display ScreenERRORLOGCLEARACTIVEMESSAGE ACTIVESYSTEM MESSAGE(The system error messages are displayed in this area)MACHINE MESSAGE(The logic messages are displayed in this area)This is the information displayed on the MESSAGE ACTIVE scr...

  • Page 58

    Basic Control OperationChapter 22-36Figure 2.10Message Log Display ScreenACTIVEERRORSTIMESTAMPSMESSAGE LOGPAGE 1 of 9SYSTEM MESSAGE(The logged system error messages are displayed inthis area)MACHINE MESSAGE(The logged logic messages are displayed in this area)This is the information displayed on ...

  • Page 59

    Basic Control OperationChapter 22-37After the cause of a machine or system message has been resolved, somemessages remain displayed on all screens until you clear them.CAUTION: Not clearing the old messages from the screen canprevent messages that are generated later from being displayed.This occ...

  • Page 60

    Basic Control OperationChapter 22-38Cursor Operation:Description:Deleting all characters onthe input lineTo delete all entered characters on the input lines press the[DEL]key while holding down the [SHIFT]key. Allcharacters on the input line are deleted.Sending informationTo send information to t...

  • Page 61

    Basic Control OperationChapter 22-39To reformat control memory and delete all programs stored in memory,follow these steps:1.Press the {PRGRAM MANAGE}softkey.(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTFRONTPANELERRORMESAGEPASS-WORDSWITCHLANG2.Press the {REFORM MEMORY}sof...

  • Page 62

    Basic Control OperationChapter 22-40This feature allows the removal of a rotary table or other axis attachmentfrom a machine. When activated, the control ignores messages that mayoccur resulting from the loss of feedback from a removed axis such asservo errors, etc.Important: This feature removes...

  • Page 63

    Basic Control OperationChapter 22-412.Press the {ACTIVE PRGRAM}softkey.REFORMMEMORYCHANGEACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMVERFYPRGRAMPRGRAMCOMENTDELETEPRGRAMRENAMEPRGRAMINPUTDEVICE(softkey level 2)DIR3.Press the {TIME PARTS}softkey. This generates the screen shown inFigure ...

  • Page 64

    Basic Control OperationChapter 22-42Important: Some softkeys shown in Figure 2.11 might not appear on yoursystem due to restricted access. Refer to the beginning of this section andpage 2-23 for details.You can modify the values on this screen. Press the {ED PRT INFO},{SET DATE}, or the {SET TIME...

  • Page 65

    Basic Control OperationChapter 22-43Power-on Time/Overall -- indicates the total accumulated time that thecontrol has been ON. This value is saved in backup memory each time thecontrol is powered off, so it is restored at its previous value each time thecontrol is turned ON. To clear this field t...

  • Page 66

    Basic Control OperationChapter 22-44Power-on Time/After Reset -- indicates the total accumulated time thatthe control has been ON. This value is saved in backup memory each timethe control is powered off, so it is restored at its previous value each timethe control is turned ON. Use this field wi...

  • Page 67

    Basic Control OperationChapter 22-45Remaining Workpieces -- indicates the number of workpieces that stillneed to be cut in the lot. The value for this field is automatically set equalto the lot size each time the “Lot Size” value is changed. When the controlencounters an M02, M30, or M99 in a...

  • Page 68

    Basic Control OperationChapter 22-46

  • Page 69

    Chapter33-1Offset Tables and SetupIn this chapter we describe the basics for job setup. Major topics include:Topic:On page:Changing the active tool offset3-14Work coordinate system offset table3-15Backing up offset tables3-19Programmable zone table3-21Single--digit feedrate table3-23Use tool offs...

  • Page 70

    Offset Tables and SetupChapter 33-2Figure 3.1Tool OffsetTool gauge points on turretfrom which tool offsets areusually measuredTool offset values simplifyprogramming and allowprocessing with differenttools without changingthe part programYou can enter this data into the tool offset tables:Tool len...

  • Page 71

    Offset Table and SetupChapter 33-3Figure 3.2Tool Dimensional OffsetsWorn cuttingedgeR’RCutting edge beforetool wearWorn cuttingedgeCutting edge beforetool wearZX/2ZXR = R’- RActual toolpositionAssumed toolpositionActual tooltip pointRTOOL WEAR, RADIUSTOOL WEAR, LENGTHTOOL GEOMETRY, LENGTHTOOL...

  • Page 72

    Offset Tables and SetupChapter 33-4Figure 3.3Tool Length Offsets-ZZtool offsetGauge pointXtool offset (enteredas a diameter value)-XThe Z offset table value corresponds to the actual Z distance from the tooltip to the gauge point. The X offset value is the distance on the axis fromthe tool tip to...

  • Page 73

    Offset Table and SetupChapter 33-5Figure 3.4Tool Tip Radius for Typical Lathe Tool.05RadiusTool Length (Wear Table)The tool length wear compensation offset takes into account the wear that atool incurs from normal usage. Enter a value in the table that is equal tothe difference between the tool t...

  • Page 74

    Offset Tables and SetupChapter 33-6ORNT - Tool Orientation (Tool Geometry Data Table)The control uses the value entered here to determine the orientation of thetool’s cutting edge relative to the surface of the part. This is necessary forthe control to perform TTRC correctly. Refer to chapter 2...

  • Page 75

    Offset Table and SetupChapter 33-7Figure 3.6Tool Orientations, Rear Turret Lathe(Both A and B Turrets if Two-Turret Lathe)-Z-X162738459 or 0Figure 3.7Tool Orientations, Front Turret Lathe(Both A and B Turrets if Two-Turret Lathe)-Z-X514237869 or 0

  • Page 76

    Offset Tables and SetupChapter 33-8You can set data in the offset tables by using one of six methods. Themethod described here requires that the offset data is manually measuredand then directly keyed into the table. The other five methods aredescribed in these sections:Using {MEASURE}(page 3-11)...

  • Page 77

    Offset Table and SetupChapter 33-9Figure 3.8Tool Offset ScreensTool Wear TableTool Geometry Table3.Move the cursor to the offset data to be modified. Use the up, down,left, or right cursor keys to move the block cursor to the tool offsetdata on the current page. Press the {MORE OFFSET}softkey to ...

  • Page 78

    Offset Tables and SetupChapter 33-10Diameter or Radius {RADI/DIAM}If the offset value being changed has been selected in AMP as thediameter axis (typically the axis perpendicular to the spindle centerline), data may be entered into the offset table as either a radius ordiameter value. The current...

  • Page 79

    Offset Table and SetupChapter 33-11The measure feature offers an easier method of establishing tool offsets.The control, not the operator, computes the tool length and wear offsets,and enters these values into the tool offset tables. The measure feature isused to measure tool length offset values...

  • Page 80

    Offset Tables and SetupChapter 33-12Tool offset range verification checks:the maximum values entering the tool offset tablesthe maximum change that can occur in either tableTo use tool offset range verification, follow this softkey sequence:1.Press the {SYSTEM SUPORT}softkey.(softkey level 1)PRGR...

  • Page 81

    Offset Table and SetupChapter 33-13Your system installer initially sets these values in AMP. You can modifythem with online AMP by using this screen:Per table valuesPer axis valuessoftkey level 5About the Offset Range Verification Screenon a lathe, range checking units for this screen are always ...

  • Page 82

    Offset Tables and SetupChapter 33-14Verify for Maximum ValueThis value represents the absolute maximum value per table for all tooloffsets in that table.If you enter:then:a positive number greater than the maximum valuethe control generates the error message:“OFFSET EXCEEDS MAX VALUE”a negati...

  • Page 83

    Offset Table and SetupChapter 33-152.Activate an offset number as follows:Press This softkey:To activate:the {TOOL GEOMET}a tool geometry offset numberthe {TOOL WEAR}tool wear offset numberThe tool offset table is displayed. Currently active offset values(if any) are indicated with an * to the ri...

  • Page 84

    Offset Tables and SetupChapter 33-16External OffsetUse the external offset to modify all of the work coordinate system zeropoints. Use of the external offset is optional. The value entered hereoffsets all of the work coordinate systems by the specified amount. Enterexternal offsets in the work co...

  • Page 85

    Offset Table and SetupChapter 33-17(softkey level 1)(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMQUICKCHECKSYSTEMSUPORTFRONTPANELERRORMESAGEPASS-WORDSWITCHLANG2.Press the {WORK CO-ORD}softkey to display the offset values for thework coordinate systems and the external offset. See Figure 3.9.(sof...

  • Page 86

    Offset Tables and SetupChapter 33-18offset data on the current page. Press the {MORE OFFSET}softkey tochange pages. The selected item appears in reverse video.4.Select data entry type:Unit selection {INCH/METRIC}To select units of “mm” or “inch” for the offset data, press the{INCH/METRIC}...

  • Page 87

    Offset Table and SetupChapter 33-19The control can save all of the information that is entered in the tool offsettables and the work coordinate system tables as a backup. This isaccomplished by the control generating a program consisting of G10blocks. These G10 blocks contain the offset numbers a...

  • Page 88

    Offset Tables and SetupChapter 33-20Figure 3.10Backup Offset Screen3.Select the offsets to be backed up by moving the cursor to the desiredoffset by using the up and down cursor keys. The selected offsetappears in reverse video. The four options include:TOOL WEAR ---- When wear is selected all da...

  • Page 89

    Offset Table and SetupChapter 33-21The programmable zone feature prevents tool motion from entering orexiting a designated area. For details on programmable zones, refer tochapter 12.This table contains the values for programmable zones 2 and 3. Thesevalues define the boundaries for the programma...

  • Page 90

    Offset Tables and SetupChapter 33-22Figure 3.11Programmable Zone TableImportant: Depending on the currently active program mode,programmable zone coordinates are displayed in inches ormillimeters for a liner axis and in degrees for a rotary axis.4.Use the up or down cursor keys to move the block ...

  • Page 91

    Offset Table and SetupChapter 33-23Use this feature to change the values set for the single--digit feedrates.When a single--digit F--word is encountered during block execution, thecontrol looks to the single--digit feedrate table for a feedrate. The feedratein this table corresponding to the sing...

  • Page 92

    Offset Tables and SetupChapter 33-246.Exit the feedrate parameter screen in two ways:Press This Softkey:To:{UPDATE & EXIT}to save recent changes made to and leave thefeedrate parameter screen.{QUIT}to exit the feedrate parameter screen withoutsaving changes.END OF CHAPTER

  • Page 93

    Chapter44-1Manual/MDI Operation ModesThis chapter describes the manual and MDI operating modes. Major topicsinclude:Topic:On page:Mechanical handle feed4-8Removing an axis4-8Manual machine homing4-9MDI mode4-11Important: This manual assumes that the rotary or push-button MTBpanel is being used an...

  • Page 94

    Manual/MDI Operation ModesChapter 44-2Figure 4.1Data Display in MANUAL ModePRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTE-STOPPROGRAM[ MM]F00000.000 MMPMX00000.000S0.0Z00000.000T1U00000.000W00000.000MEMORY 30000 MDISTOPN 99999(First 4 blocksof program shown here)(PAL messages)In the jog mo...

  • Page 95

    Manual/MDI Operation ModesChapter 44-3The control can be equipped with an optional offset jogging feature,activated by a switch installed by the system installer. When this feature isactive, all jog moves are used to offset the current work coordinate systemand no position registers are changed. ...

  • Page 96

    Manual/MDI Operation ModesChapter 44-43.Press the <AXIS/DIRECTION>button for the axis and direction to jog.The control makes one incremental move each time the<AXIS/DIRECTION>button is recognized. Until the control completesthe execution of the incremental move, no other jog moves are...

  • Page 97

    Manual/MDI Operation ModesChapter 44-5Figure 4.2HPG Feed-+If desired the system installer can enable a feature that allows control overthe angle in which a multi-axis jog move will take through the installationof some optional switches.When this feature is activated, the operator selects two diff...

  • Page 98

    Manual/MDI Operation ModesChapter 44-6The control may be equipped with an optional jog offset feature, activatedby a switch installed by the system installer. When this function is active,all jog moves made are added as offsets to the current work coordinatesystem.Normally, jogging occurs in the ...

  • Page 99

    Manual/MDI Operation ModesChapter 44-7Programmable Zone Overtravel ---- the axes reach a travel limitestablished by independent programmable areas. Programmable Zonesare activated through programming the appropriate G-code.These 3 causes of overtravel are described in detail in chapter 12.When an...

  • Page 100

    Manual/MDI Operation ModesChapter 44-8This feature lets you disable the servo drives, and allows the axes to bemoved by external means (such as a hand crank attached to the ball screw)without requiring the control to be in E-Stop. When this feature is enabled,all position displays get updated as ...

  • Page 101

    Manual/MDI Operation ModesChapter 44-9The machine home return operation means the positioning of a specifiedlinear or rotary axis to a machine-dependent fixed position, which is calledthe machine home. This position is established via a home limit switchmounted on the machine and the encoder mark...

  • Page 102

    Manual/MDI Operation ModesChapter 44-10Figure 4.4Manual Machine HomeMachine homeAXIS/DIRECTIONCutting tool+X+4--X+YTRVRS--Y+Z--4--ZJOG SELECTINCRCONTHANDHOMETo execute the manual return to machine home position:1.Select HOME under <JOG SELECT>.2.Place the control in manual mode. See page 4-...

  • Page 103

    Manual/MDI Operation ModesChapter 44-11This locates the machine home position. When the axis reaches thisposition, the control resets the position registers to a machine coordinatevalue specified in AMP. This establishes the zero point of the machinecoordinate system.Important: During the machine...

  • Page 104

    Manual/MDI Operation ModesChapter 44-12Figure 4.5Program Display Screen in MDI ModePRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTE-STOPPROGRAM[ MM]F00000.000 MMPMX00000.000S0Z00000.000T1U00000.000W00000.000MEMORY 30000 MDISTOPN 99999(First 4 blocksof MDI shown here)(PAL messages)Operating p...

  • Page 105

    Manual/MDI Operation ModesChapter 44-133.Pressing the [TRANSMIT]key transmits the blocks to control memory.Once the blocks have been sent to control memory, you cannot sendany more MDI blocks until all of the previous set has been executed.The control displays the first 4 blocks of the MDI progra...

  • Page 106

    Manual/MDI Operation ModesChapter 44-14Figure 4.6MDI Mode Program ScreenPRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTE-STOPPROGRAM[ MM]F00000.000 MMPMZ00000.000S0R X00000.000T1C359.99MEMORY 30000 MDISTOPN 99999(First 4 blocksof MDI shown here)(PAL messages)Important: Performing a block res...

  • Page 107

    Chapter55-1Editing Programs On LineThis chapter describes the basics for editing programs on line (at thekeyboard), including:Topic:On page:Selecting the program to edit5-2Editing programs5-4Programming aids {QUICKVIEW}5-16Digitizing a program (Teach)5-28Deleting program {DELETE}5-36Renaming prog...

  • Page 108

    Editing Programs On LineChapter 55-2This section provides information on how to select a part program forediting. You can only edit part programs on line that you have stored incontrol memory. If a part program is on tape or another storage device andyou must edit it on line, copy this program to...

  • Page 109

    Editing Programs On LineChapter 55-3The control displays this main part program directory screen:Figure 5.1Part Program DirectoryACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMSELECTED PROGRAM:DIRECTORYPAGE1OF1NAMESIZECOMMENTMAIN2.3O1234514.3RRR9.3THIS IS A TEST PROGTEST3.94 FILES120.2ME...

  • Page 110

    Editing Programs On LineChapter 55-43.Press the {EDIT PRGRAM}softkey.REFORMMEMORYCHANGEDIRACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMVERIFYPRGRAMPRGRAMCOMENTDELETEPRGRAMRENAMEPRGRAMINPUTDEVICE(softkey level 2)This section covers how to edit part programs after a program has alreadybe...

  • Page 111

    Editing Programs On LineChapter 55-5Figure 5.2Program Edit ScreenINSERT :EDITFILE : 000001POS1*1 MODE : CHARN00020WHILE [#1LT 10] DO 1;N00025G01 F1000X#1;N00030G04 P1N00035#1 = [#1 + 1];N00040END 1;N00050M99;MODIFYINSERTBLOCKDELETEBLOCKTRUNCDELETECH/WRDEXITEDITORThe maximum number of programs tha...

  • Page 112

    Editing Programs On LineChapter 55-6This section describes moving the cursor in the program display area (lines7-20 of the CRT). It assumes that you have selected a program to edit asoutlined on page 5-2 .Important: The input cursor is the cursor shown on the input lines (lines 2and 3 on the scre...

  • Page 113

    Editing Programs On LineChapter 55-74.To end the search operation, press the exit [Ý] softkey.Sometimes you might want to change the cursor size for editing operationssuch as changing, inserting, or erasing. The control has two cursor sizesavailable.Cursor Size:Description:single characteris aut...

  • Page 114

    Editing Programs On LineChapter 55-82.Type the program characters to be entered in the input area. Press the[EOB]key (end of block) at the end of each block.If you make a mistake keying in a character before it is sent from theinput area, you can edit the input lines as described on page 2-37.3.P...

  • Page 115

    Editing Programs On LineChapter 55-9Example 5.1Changing CharactersTo change Z93 to W93 in the following block:Program Block(Program Display Area)Enter(Input Area)NotesG01X93Z93;Move the block cursor to the Z in the program display area and togglethe {MODIFY/INSERT}softkey to “MODIFY:”.G01X93Z...

  • Page 116

    Editing Programs On LineChapter 55-10InsertingYou can insert characters, words, and blocks to the left of the programdisplay cursor within an already existing or newly created part program.Follow these steps to use the insert function.1.From the edit menu, press the {MODIFY INSERT}softkey until t...

  • Page 117

    Editing Programs On LineChapter 55-11Example 5.5Inserting CharactersTo change “X123.0” to “X123.034” when the following is displayed on theinput line:Program Block(Program Display Area)Enter(Input Area)NotesN1000X123.0Z45.0;Move the cursor to “Z”and toggle the {MODIFY/INSERT}softkey t...

  • Page 118

    Editing Programs On LineChapter 55-123.Press the {DELETE CH/WRD}softkey.DIGITZEMODIFYINSERTBLOCKDELETEBLOCKTRUNCDELETECH/WRDEXITEDITORSTRINGSEARCHRENUMPRGRAMMERGEPRGRAMQUICKVIEWCHAR/WORD(softkey level 3)Erasing Commands to the EOB1.Move the cursor from the edit menu until the first character or w...

  • Page 119

    Editing Programs On LineChapter 55-13Erasing An Entire Block1.Move the cursor from the edit menu until it is located on anycharacter in the block that you want to delete.2.Press the {BLOCK DELETE}softkey. This erases the selected block,including the end of block character.DIGITZEMODIFYINSERTBLOCK...

  • Page 120

    Editing Programs On LineChapter 55-14You can assign each block in a part program up to a five-digit numericvalue following an N address. Refer to these numbers as sequencenumbers. They distinguish one block from another.You can assign sequence numbers at random to specific blocks or to allblocks....

  • Page 121

    Editing Programs On LineChapter 55-154.Select the blocks to renumber. There are two choices:If you want to assign sequence numbers to:Press:all blocks from the beginning of the part program{ALL}only the block that already have sequence numbers{ONLY N}Important: Any sequence numbers in a block tha...

  • Page 122

    Editing Programs On LineChapter 55-16When you edit a program, all changes and additions that you make aresaved immediately in the control’s memory. You don’t execute a formal“save” command.Important: You cannot quit, abandon or abort an edit session and restorethe original version of the ...

  • Page 123

    Editing Programs On LineChapter 55-17How to Select QuickView FeaturesUse these steps to select the QuickView features:1.Select a program for editing as described on page 5-2 .2.From the edit menu, press the {QUICK VIEW}softkey.The softkey functions change to those indicated below:QPATH+PROMPTGCOD...

  • Page 124

    Editing Programs On LineChapter 55-18With the QuickView functions and the QuickPath Plus section, you can usedimensions from part drawings to create a part program. The samplepatterns available with the QuickPath Plus prompts are summarized below:Use thispattern:When you program this geometry:And...

  • Page 125

    Editing Programs On LineChapter 55-19For more information regarding these designations, see chapters 15 and 16.Your system installer can select a different address for angle A in AMP.Refer to your system installer’s documentation.Axis words followed by a (1), (2), or (3) are prompting for the f...

  • Page 126

    Editing Programs On LineChapter 55-20CIRCLE, ANGLE, POINTANGLE, CIRCLE, POINTANGLE, POINTCIRCLE , CIRCLECIRANG PTCIRCIRANGCIR PTANGPTQUICKPATH PLUS MENU 13.After you select the sample pattern you want, enter values for theparameters as follows:Use the up and down cursor keys to select the paramet...

  • Page 127

    Editing Programs On LineChapter 55-21After you press the {3PT C}softkey, the prompt screen for that samplepattern becomes available. Figure 5.4 is an example of a QuickPath Plusprompting screen. It shows what data must be entered for that promptedscreen to generate the necessary tool paths correc...

  • Page 128

    Editing Programs On LineChapter 55-22Figure 5.5G-code Prompt Select ScreenG CODE PROMPTING MENU DISPLAYPAGE1 OF3G00/01RAPID/LINEAR INTERPOLATIONG02/03CIRCULAR/HELICAL INTERPOLATION, CW/CCWG04DWELLG07/G08RADIUS/DIAMETER PROGRAMMINGG09/61/62/CUTTING MODE SELECTION63/64G10L2WORK COORDINATE SYSTEM TA...

  • Page 129

    Editing Programs On LineChapter 55-236.After you enter all data for the G-code, store the data press the{STORE}softkey.STORECONTNU(softkey level 6)The control generates the necessary G-code block. The generatedblock displays in the input area next to the EDIT: prompt. You canedit this block in th...

  • Page 130

    Editing Programs On LineChapter 55-24SELECTE-STOPLATHE PROMPT MENUDISPLAY.G20: SINGLE PASS O.D. & I.D. ROUGHING CYCLEG21: SINGLE PASS THREADING CYCLEG24: SINGLE PASS ROUGH FACING CYCLEG72: O.D. & I.D. FINISHING CYCLEG73: O.D. & I.D. ROUGHING CYCLEG74: ROUGH FACING CYCLEG75: CASTING/FO...

  • Page 131

    Editing Programs On LineChapter 55-256.After you enter all data for the G-code, store the data by pressing the{STORE}softkey.STORE(softkey level 6)The control generates the necessary G-code block. The generatedblock is displayed in the input area next to the EDIT: prompt. Thisblock may be edited ...

  • Page 132

    Editing Programs On LineChapter 55-26SELECTDRILLPROMPTMENU DISPLAYG80: CANCEL OR END FIXED CYCLEG81: DRILLING CYCLE, NO DWELL/RAPID OUTG82: DRILLING CYCLE DWELL/RAPID OUTG83: DEEP HOLE DRILLING CYCLEG83.1: DEEP HOLE PECK DRILLING CYCLE, DWELLG84: RIGHT HAND TAPPING CYCLEG84.1: LEFT HAND TAPPING C...

  • Page 133

    Editing Programs On LineChapter 55-27STORE(softkey level 6)The control generates the necessary G-code block. The generatedblock is displayed in the input area next to the EDIT: prompt. Thisblock may be edited in the input area using the techniques describedon page 2-37.7.To enter the blocks in th...

  • Page 134

    Editing Programs On LineChapter 55-282.Change the plane by pressing the softkey that corresponds to theplane you want to program in (G17, G18, or G19). Refer todocumentation prepared by your system installer for details on theplanes selected by these G-codes.The display changes to show the select...

  • Page 135

    Editing Programs On LineChapter 55-292.From the edit menu, press the {DIGITIZE}softkey.DIGITZEMODIFYINSERTBLOCKDELETEBLOCKTRUNCDELETECH/WRDEXITEDITORSTRINGSEARCHRENUMPRGRAMMERGEPRGRAMQUICKVIEWCHAR/WORD(softkey level 3)3.Use the following methods to position the cutting tool. The cuttingtool shoul...

  • Page 136

    Editing Programs On LineChapter 55-30Table 6.AChanging Programming Modes During DigitizingMode Changed To:AbbreviationG-code GeneratedSoftkeyAbsolute modeABS (Except Lathe A)G90 1{ABS/INCR}Incremental modeINC (Except Lathe A)G91 1{ABS/INCR}Plane selectedG17,G18,G19G17, G18, G19{PLANESELECT}Diamet...

  • Page 137

    Editing Programs On LineChapter 55-31If the next move is to be linear, press the {LINEAR}softkey(page 5-31)If the next move is to be circular:Press:If you know:{CIRCLE 3 PNT}three points on the arc (see page 6.42){CIRCLE TANGNT}the end-point of the arc and the line that is tangent to thestart-poi...

  • Page 138

    Editing Programs On LineChapter 55-32STOREEND PTEDIT &STOREE-STOPDIGITIZE:TARGET[ MM]Z0.000RX0.000C359.99F0.000 MMPM S002.Reposition the tool at the desired end-point of the linear move usingany of these methods:Jog the Axes in manual mode.Automatically move the axes by executing a part progr...

  • Page 139

    Editing Programs On LineChapter 55-33The following subsection assumes that steps 1-5 in on page 5-28 havebeen completed to initiate a digitizing operation.To digitize an arc:1.Press the {CIRCLE 3 PNT}softkey if you know 3 points on the circle.When you press the {CIRCLE 3 PNT}softkey, the control ...

  • Page 140

    Editing Programs On LineChapter 55-343.After the second point on the arc has been stored reposition the axesat the end point of the arc. Store this block as a circular block bypressing either the {STORE END PT}or the {EDIT & STORE}softkeys.This records the current tool location as the final p...

  • Page 141

    Editing Programs On LineChapter 55-35Figure 5.6CIRCLE TANGNT Digitize ScreenSTOREEND PTEDIT &STOREE-STOPDIGITIZE:TARGET[ MMZ- 0.000RX- 0.000C-359.99F0.000 MMPMS002.Reposition the tool at the end point of the arc using any of thesemethods:Jog the Axes in manual mode.Automatically move the axes...

  • Page 142

    Editing Programs On LineChapter 55-36If you press:It:{STOREEND PT}does not return the control to the program display screen.Pressing this softkey inserts the generated block at whateverlocation the cursor was last at and allows the operator toimmediately begin entering the next block using this s...

  • Page 143

    Editing Programs On LineChapter 55-372.Press the {DELETE PRGRAM}softkey.REFORMMEMORYCHANGEDIRACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMVERIFYPRGRAMPRGRAMCOMENTDELETEPRGRAMRENAMEPRGRAMINPUTDEVICE(softkey level 2)3.Select one of these two choices:Key in the the program name and press ...

  • Page 144

    Editing Programs On LineChapter 55-382.Press the {RENAME PRGRAM}softkey.REFORMMEMORYCHANGEDIRACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMDELETEPRGRAMVERIFYPRGRAMPRGRAMCOMENTRENAMEPRGRAMINPUTDEVICE(softkey level 2)3.Key in the current program name or cursor down until the desiredprogra...

  • Page 145

    Editing Programs On LineChapter 55-392.Select the input device using the {INPUT DEVICE}softkey (asdescribed in chapter 7). This is only necessary if the currently activeinput device is not the device that the part program to display iscurrently resident on. The default input device is control mem...

  • Page 146

    Editing Programs On LineChapter 55-40To assign a comment to a program without using a comment block as thefirst block of the program, follow the steps below:1.Press the {PRGRAM MANAGE}softkey. This displays the programdirectory screen. Any existing comments that have previously beenassigned to a ...

  • Page 147

    Editing Programs On LineChapter 55-41This section describes making a duplicate of a part program in controlmemory. To input or output a part program from/to a peripheral device,see the sections on inputting or outputting programs in chapter 9.To copy part programs stored in memory using different...

  • Page 148

    Editing Programs On LineChapter 55-42Important: The control displays the active communication parameters ifone of the communication ports has been chosen. If the communicationport parameters do not match that of the peripheral device, they must bealtered for a successful copy to take place. For d...

  • Page 149

    Editing Programs On LineChapter 55-43To access the protectable part program directory:1.Press the {PRGRAM MANAGE}softkey.(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTFRONTPANELERRORMESAGEPASS-WORDSWITCHLANGThe control displays the main program directory screen:ACTIVEPRGRAM...

  • Page 150

    Editing Programs On LineChapter 55-442.Press the {CHANGE DIR}softkey.REFORMMEMORYCHANGEDIRACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMVERIFYPRGRAMPRGRAMCOMENTDELETEPRGRAMRENAMEPRGRAMINPUTDEVICE(softkey level 2)Important: The control does not display the {CHANGE DIR}softkeyif your pass...

  • Page 151

    Editing Programs On LineChapter 55-45The programs in this directory are protected. This means:they are processed the same as unprotected programsthe blocks of protected programs are not displayed during programexecution unless you have access to the {CHANGE DIR}softkey (in placeof the protected p...

  • Page 152

    Editing Programs On LineChapter 55-46To set-up the character encryption/decryption table:1.Select the protected part program directory.2.Press the {SET-UP NCRYPT}softkey.REFORMMEMORYCHANGEDIRNCRYPTMODESET-UPNCRYPTACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMVERIFYPRGRAMPRGRAMCOMENTDELE...

  • Page 153

    Editing Programs On LineChapter 55-47To fill in the encryption/decryption table by using the operator panelkeys:use the arrow keys to move the cursor to the place where you wantto assign an encryption/decryption characterenter a character and press the [TRANSMIT]keyYou must enter a unique charact...

  • Page 154

    Editing Programs On LineChapter 55-48When you press the {UPDATE & EXIT}softkey, the control does acompile/check of the encryption/decryption table to determine thatno duplicate characters exist and that no characters were left blank.If a character is: the control displays:and moves the cursor...

  • Page 155

    Editing Programs On LineChapter 55-493.Press the {STORE BACKUP}softkey. The control displays the message“STORING TO BACKUP -- PLEASE WAIT” on the CRT until thecontrol has finished storing the encryption/decryption table in itsbackup memory.UPDATE& EXITSTOREBACKUPREVRSEFILL(softkey level 3...

  • Page 156

    Editing Programs On LineChapter 55-50

  • Page 157

    Chapter66-1Editing Part Programs Off Line (ODS)This chapter describes how to use the Offline Development System (ODS)to edit part programs. Major sections include:Topic:On page:Selecting the part program application6-2Editing off line6-3Interfacing with the control6-6Downloading from ODS6-6Upload...

  • Page 158

    Editing Part Programs Off LineChapter 66-2Selecting the Part Program application provides access to the part programutilities of ODS. To select the Part Program application:1.Return to the main menu line of ODS.2.Press [F3]to pull down the Application menu:The workstation displays this screen:F1 ...

  • Page 159

    Editing Part Programs Off LineChapter 66-3Use the Edit Part Program utility of ODS to edit part programs on aworkstation. Programs that already exist on the control can be uploaded tothe workstation for editing. These programs or programs created usingODS can be edited using the screen or text ed...

  • Page 160

    Editing Part Programs Off LineChapter 66-43.Press [E]to select the Part Program option.The workstation displays this screen:F1 - FileF2 - ProjectF3 - ApplicationF4 - UtilityF5 - ConfigurationProj: DemoAppl: Part ProgramUtil: File ManagementFILE1 FILE2 FILE3Editing Part Program ...Selecting New or...

  • Page 161

    Editing Part Programs Off LineChapter 66-5After you select a file, the workstation displays a screen explainingthe text editor:F1 - FileF2 - ProjectF3 - ApplicationF4 - UtilityF5 - ConfigurationProj: DemoAppl: Part ProgramUtil: File ManagementThe configured text editor will now be executed,using ...

  • Page 162

    Editing Part Programs Off LineChapter 66-6The following sections require that the workstation be connected to thecontrol or storage device. Connect the workstation to the control orstorage device with the RS-232 serial interface cable (cable CN25 in theintegration/maintenance manual, chapter 4).U...

  • Page 163

    Editing Part Programs Off LineChapter 66-7To download a part program from ODS to the control’s memory, followthese steps:1.Interface the workstation with the control. See page 6-6.2.Return to the main menu line of ODS.3.Press [F3]to pull down the Application menu.The workstation displays this s...

  • Page 164

    Editing Part Programs Off LineChapter 66-85.Press [F4]to pull down the Utility menu.F1 - FileF2 - ProjectF3 - ApplicationF4 - UtilityF5 - ConfigurationProj: DemoAppl: DownloadUtil: File ManagementSend AMP paramsSend PAL and I/OSend Part Program(A)(P)(R)6.Use the arrow keys to highlight the Send P...

  • Page 165

    Editing Part Programs Off LineChapter 66-97.Use the arrow keys to highlight the download destination or press theletter that corresponds to the download destination. When selected,press [ENTER].The workstation displays the part program files that are stored in theactive project directory of the w...

  • Page 166

    Editing Part Programs Off LineChapter 66-10If the selected part program file name already exists on the control, theworkstation displays this screen:F1 - FileF2 - ProjectF3 - ApplicationF4 - UtilityF5 - ConfigurationProj: DemoAppl: DownloadUtil: Get Part ProgramFile Already ExitsEnter OptionRenam...

  • Page 167

    Editing Part Programs Off LineChapter 66-11After selecting the Rename or Overwrite option, or if the file beingdownloaded did not already exist on the control, the workstation displaysthis screen:F1 - FileF2 - ProjectF3 - ApplicationF4 - UtilityF5 - ConfigurationProj: DemoAppl: DownloadUtil: Send...

  • Page 168

    Editing Part Programs Off LineChapter 66-12When the download process is complete, the workstation displays thisscreen:F1 - FileF2 - ProjectF3 - ApplicationF4 - UtilityF5 - ConfigurationProj: DemoAppl: DownloadUtil: Send Part ProgramDownload CompleteDownload Another File?YesNo(Y)(N)9.Select “Yes...

  • Page 169

    Editing Part Programs Off LineChapter 66-13If the workstation was unable to complete the download procedure inthe allotted time frame, it displays this screen:F1 - FileF2 - ProjectF3 - ApplicationF4 - UtilityF5 - ConfigurationProj: DemoAppl: DownloadUtil: Send Part ProgramA time-out occurred ...P...

  • Page 170

    Editing Part Programs Off LineChapter 66-143.Press [F3]to pull down the Application menu.The workstation displays this screen:F1 - FileF2 - ProjectF3 - ApplicationF4 - UtilityF5 - ConfigurationProj: PALTESTAppl: UploadUtil: Get PAL I/OAMPPALI/O AssignmentsPart ProgramUploadDownload(A)(P)(I)(R)(U)...

  • Page 171

    Editing Part Programs Off LineChapter 66-156.Use the arrow keys to highlight the Get Part Program option, thenpress[ENTER], or press [R].The workstation displays this screen:F1 - FileF2 - ProjectF3 - ApplicationF4 - UtilityF5 - ConfigurationProj: DemoAppl: Part ProgramUtil: Get Part ProgramUpload...

  • Page 172

    Editing Part Programs Off LineChapter 66-168.Use the arrow keys to highlight the name of the part program to beuploaded to the workstation or type in the part program name, thenpress [ENTER].When you upload a program from the control, the control does not displaya message to indicate that an uplo...

  • Page 173

    Editing Part Programs Off LineChapter 66-17If you select the Rename option, the workstation renames the existing file,which has the same name as the file being uploaded, on the workstation.The workstation displays the part program files stored on the workstation:F1 - FileF2 - ProjectF3 - Applicat...

  • Page 174

    Editing Part Programs Off LineChapter 66-18If the name of the part program that was entered does not exist on theworkstation or the Overwrite option was selected the workstation displaysthis screen:F1 - FileF2 - ProjectF3 - ApplicationF4 - UtilityF5 - ConfigurationProj: DemoAppl: UploadUtil: Get ...

  • Page 175

    Editing Part Programs Off LineChapter 66-19After the part program has been uploaded to the workstation, theworkstation displays this screen:F1 - FileF2 - ProjectF3 - ApplicationF4 - UtilityF5 - ConfigurationProj: DemoAppl: UploadUtil: Get Part ProgramUpload CompleteUpload Another File?YesNo(Y)(N)...

  • Page 176

    Editing Part Programs Off LineChapter 66-20

  • Page 177

    Chapter77-1Running a ProgramThis chapter describes how to test a part program and execute it inautomatic mode. Major topics include:Topic:On page:Selecting special running condition7-1Selecting a part program input device7-5Selecting a program7-6De-selecting a part program7-8Program search7-9Prog...

  • Page 178

    Running a ProgramChapter 77-2When the MISCELLANEOUS FUNCTION LOCK is made active, thecontrol displays M-, second auxiliary functions (B-codes), S-, and T-codesin the part program and activates the corresponding Tool Wear Offset,except for M00, M01, M02, M30, M98, M99, and M100-M199.M100-M199 are ...

  • Page 179

    Running a ProgramChapter 77-32.Press the {ACTIVE PRGRAM}softkey.REFORMMEMORYCHANGEDIRACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMDELETEPRGRAMVERIFYPRGRAMPRGRAMCOMENTRENAMEPRGRAMINPUTDEVICE(softkey level 2)3.Press the {SEQ STOP}softkey.(softkey level 3)DE-ACTPRGRAMSEARCH MID STPRGRAMT ...

  • Page 180

    Running a ProgramChapter 77-4In single block mode, the control executes the part program block byblock. Each time you press the <CYCLE START>button, the controlexecutes one block of commands in the part program when in single blockmode.Figure 7.1Single BlockSINGLEBLOCKCYCLESTARTCutting tool...

  • Page 181

    Running a ProgramChapter 77-5Before selecting a part program, you must tell the control where this partprogram is currently residing. There are 3 options here:the program can be resident in the control’s memorythe program can be resident on a peripheral device attached to port Asuch as a tape r...

  • Page 182

    Running a ProgramChapter 77-63.Press the softkey corresponding to the location where the partprogram is to be read from, {FROM PORT A}, {FROM PORT B}, or{FROM MEMORY}.(softkey level 3)FROMPORT AFROMPORT BFROMMEMORYTo activate a part program, it must be selected as described on page 8.3.To select ...

  • Page 183

    Running a ProgramChapter 77-7This screen appears:ACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMSELECTED PROGRAM:DIRECTORYPAGE1OF1NAMESIZECOMMENTTESTAE3.9O123451.3SUB TEST 1MAIN1.3SHAFT21.3THIS IS A TEST PROGRAMXXX1.35 FILES137.8 METERS FREEImportant: This screen shows program TEST as ac...

  • Page 184

    Running a ProgramChapter 77-83.Press the {ACTIVE PRGRAM}softkey to activate the selected program.The control displays the part program name, followed by the first fewblocks of the selected program.Important: The following softkey level 2 indicates that the control isusing control memory as an inp...

  • Page 185

    Running a ProgramChapter 77-92.Press the {ACTIVE PRGRAM}softkey. The control displays the firstfew blocks of the currently active program.REFORMMEMORYCHANGEDIRACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMDELETEPRGRAMVERIFYPRGRAMPRGRAMCOMENTRENAMEPRGRAMINPUTDEVICE(softkey level 2)3.If t...

  • Page 186

    Running a ProgramChapter 77-10To perform a program search operation:1.Press the {PRGRAM MANAGE}softkey. The program to search musthave been previously selected for automatic execution as described inpage 7-6.(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTFRONTPANELERRORMESAG...

  • Page 187

    Running a ProgramChapter 77-114.Choose from the 6 search options:If you are searching for:Press this softkey:a sequence number{N SEARCH}an O-word{O SEARCH}the end of each block{EOB SEARCH}the program one line at a time{SLEW}a specific character string{STRING SEARCH}the beginning of your next prog...

  • Page 188

    Running a ProgramChapter 77-12When you press the {NEXT PRGRAM}softkey, the control firstsearches for a valid program end code. See setting communications,chapter 9. After it finds the program end code, it advances to theprogram start code of the next program. If the current program is thelast pro...

  • Page 189

    Running a ProgramChapter 77-13Important: Incremental moves that occur during a program search withrecall operation, are always referenced from the last known absoluteposition in the part program. If no absolute position is specified in thesearched part program blocks, the control will use the cur...

  • Page 190

    Running a ProgramChapter 77-14To perform a program search with recall, follow these steps:1.Press the {PRGRAM MANAGE}softkey.(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMQUICKCHECKSYSTEMSUPORTFRONTPANELERRORMESAGEPASS-WORDSWITCHLANG2.Press the {ACTIVE PRGRAM}softkey.REFORMMEMORYACTIVEPRGRAMEDITP...

  • Page 191

    Running a ProgramChapter 77-155.Key in the desired character string or sequence number to search forand press the [TRANSMIT]key. The control locates an @ symbol tothe left of the block immediately before the block that automaticexecution begins from.If this is not the block to begin execution fro...

  • Page 192

    Running a ProgramChapter 77-16{EXIT & MOVE}- Use this softkey if the tool is not at the exactlocation for execution of the searched block. Be aware that theabsolute position of the axes necessary at the start of the searchedblock is dependant on the previous blocks. There can be offsetsactiva...

  • Page 193

    Running a ProgramChapter 77-17After a program is written or loaded into the control, it should bethoroughly tested before a part is mounted and machined. The controloffers 3 distinct testing modes in addition to fully automatic operation.These modes are briefly described below in the order in whi...

  • Page 194

    Running a ProgramChapter 77-18(1) Pressing <CYCLE STOP>When you press the <CYCLE STOP>button, motion of the cutting tooldecelerates and stops, and the control stops automatic operation. If youpress the <CYCLE STOP>button during a dwell, the dwell is interrupted andany remaining ...

  • Page 195

    Running a ProgramChapter 77-19To use the QuickCheck feature, follow these steps.1.Select a program to check as described on page 7-5 and return tosoftkey level 1.2.Press the {PRGRAM CHECK}softkey.(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTFRONTPANELERRORMESAGEPASS-WORDSW...

  • Page 196

    Running a ProgramChapter 77-20To disable QuickCheck with or without graphics, press the {STOP CHECK}softkey.CAUTION: Note that when a program is run during quickcheck mode, the control performs all coordinate system offsetoperations. This means that changes to the coordinate systemsor coordinate ...

  • Page 197

    Running a ProgramChapter 77-21You can activate the Axis Inhibit feature using a switch installed by yoursystem installer (see documentation provided by the system installer) or byusing the {FRONT PANEL}softkey (see page 2-13). The control must be incycle stop or E-Stop to activate or deactivate t...

  • Page 198

    Running a ProgramChapter 77-22You can use the <FEEDRATE OVERRIDE>to modify the cutting feedrate.Your system installer determines in AMP if rapid feedrates are overridesby the <RAPID FEEDRATE OVERRIDE>switch/button or the <FEEDRATEOVERRIDE>switch during Dry Run.CAUTION: When test...

  • Page 199

    Running a ProgramChapter 77-23The Dry Run feature can be activated using a switch installed by yoursystem installer (see documentation provided by your system installer) orby using the {FRONT PANEL}softkey (see page 2-13).Automatic mode is the normal operating mode of the control. A programthat i...

  • Page 200

    Running a ProgramChapter 77-24Command:Process:CYCLE START begins part program executionCYCLE STOPstops part program executionWARNING: Always test a program prior to automaticoperation. Always verify that the workspace is clear and allsafety features are intact before pressing <CYCLE START>....

  • Page 201

    Running a ProgramChapter 77-25Use the program recover feature to resume a program that was executingand was interrupted by some means such as a control reset, E-Stop, or evenpower failure in some cases. This feature will scan the program as itsearches for the interrupted block and from within the...

  • Page 202

    Running a ProgramChapter 77-26CAUTION: When a program recover is performed the controlautomatically returns the program to the beginning of the blockthat was originally interrupted. The beginning of the block isprobably not the point that axis motion was interrupted. Forabsolute linear moves this...

  • Page 203

    Running a ProgramChapter 77-27To perform a program restore operation after automatic program executionhas been interrupted follow these steps:1.Press the {PRGRAM MANAGE}softkey.(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMQUICKCHECKSYSTEMSUPORTFRONTPANELERRORMESAGEPASS-WORDSWITCHLANGImportant: D...

  • Page 204

    Running a ProgramChapter 77-28CAUTION: When you exit a program restart operation (searchwith memory), M- and S-codes are sent to PAL. If, duringnormal execution, that program activated a spindle,mid-program start may also start it.4.Press the {EXIT}softkey if the block selected is the block to be...

  • Page 205

    Running a ProgramChapter 77-29CAUTION: If the Jog Retract function is deactivated during itsexecution (performing a control reset, E-Stop, etc.), attemptingto return the tool by pressing <CYCLE START>can cause the JogRetract function to abort. The program returns to the start pointof jog re...

  • Page 206

    Running a ProgramChapter 77-30Figure 7.5Jog Retract OperationJog retract exit movesJog retract return movesIn Figure 7.5 the control only recognized 6 jog moves upon returninginstead of the actual 11 moves that were made to retract the tool. This isbecause the jog retract feature records consecut...

  • Page 207

    Running a ProgramChapter 77-31Figure 7.6Jog Retract Moves that Exceed the Maximum Allowed in AMP1234567Return pathFigure 7.6 emphasizes the possible problems that can result fromexceeding the maximum allowed jog retract moves. In this example, thenumber of allowed moves set in AMP is four.When yo...

  • Page 208

    Running a ProgramChapter 77-32To perform a block retrace operation:1.Press the <CYCLE STOP>or activate the <SINGLE BLOCK>featurebutton to stop program execution.2.Press the <BLOCK RETRACE>button.After you press the <BLOCK RETRACE>button, the control retraces the blockthat ...

  • Page 209

    Running a ProgramChapter 77-33The block retrace function is unable to retrace any of these blocks and anattempt to do so results in an error message:ThreadingTappingBoringInch/Metric changes (unit conversion)A block that commands a tool change operationA block that commands a change in the coordi...

  • Page 210

    Running a ProgramChapter 77-34

  • Page 211

    Chapter88-1Display and GraphicsThe first part of this chapter gives a description of the different datadisplays available on the control. The second part gives a description ofthe control’s graphics capabilities.Pressing the [DISP SELECT]key displays the softkeys for selecting theaxis position ...

  • Page 212

    Displays and GraphicsChapter 88-2The screens described above may also show in addition to axis position:The current unit system being used (millimeters or inches)E-StopThe current feedrateThe current spindle speed of the controlling spindleThe current tool and tool offset numbersThe active progra...

  • Page 213

    Displays and GraphicsChapter 88-33.To return to softkey level 1, press the [DISP SELECT]key again. Themost recently selected data position screen will remain in effect forsoftkey level 1 until either power is turned off or a different positiondisplay screen is selected. The default screen selecte...

  • Page 214

    Displays and GraphicsChapter 88-4{PRGRAM} (Large Display)Axis position in the current work coordinate system displayed in largecharacters.Figure 8.2Results After Pressing {PRGRAM}(Large Display) SoftkeyPRGRAM A B STARGETD T G AXISSELECTE-STOPPROGRAM[ MM](ACTIVE PROGRAM NAME)X-7483 .647Z-7483 .647...

  • Page 215

    Displays and GraphicsChapter 88-5{PRGRAM} (Small Display)Axis position in the current work coordinate system displayed for allsystem axes in the active process (only available when more than 9 axis areAMPed in the system, or more than 8 axis in the process for dual processsystems).Figure 8.3Resul...

  • Page 216

    Displays and GraphicsChapter 88-6{ABS}The axis position data in the machine coordinate system.Figure 8.4Results After Pressing {ABS}SoftkeyE-STOPABSOLUTE[ MM]F0.000 MMPMX0.000S00Z0.000T 0U-0.035(ACTIVE PROGRAM NAME)MEMORYMANSTOPPRGRAM A B STARGETD T G AXISSELECT

  • Page 217

    Displays and GraphicsChapter 88-7{ABS}(Large Display)Axis position in the machine coordinate system displayed in largecharacters.Figure 8.5Results After Pressing {ABS}(Large Display) SoftkeyPRGRAM A B STARGETD T G AXISSELECTE-STOPABSOLUTE[ MM](ACTIVE PROGRAM NAME)X0.000Z0.000U-0.035F0.000 MMPM S0...

  • Page 218

    Displays and GraphicsChapter 88-8Figure 8.6Results After Pressing {ABS}(Small Display) SoftkeyPRGRAM A B STARGETD T G AXISSELECTABSOLUTE[ MM]X-9999.647Y-3333.647Z-1111.647U-2222.647V-2222.647W-2222.647A-2222.647B-2222.647C-2222.647$X -2222.647$Y -2222.647$Z -2222.647F0.000 MMPMS00

  • Page 219

    Displays and GraphicsChapter 88-9{TARGET}The coordinate values of the end point of the currently executing axismove is displayed at a position in the current work coordinate system.Figure 8.7Results After Pressing {TARGET}SoftkeyTARGET[ MM]F0.000 MMPMX -7483.647S00Z -7483.647T 0U -7483.647(ACTIVE...

  • Page 220

    Displays and GraphicsChapter 88-10{TARGET} (Large Display)The coordinate values in the current work coordinate system, of the endpoint of commanded axis moves in normal size characters.Figure 8.8Results after Pressing {TARGET}SoftkeyPRGRAM A B STARGETD T G AXISSELECTE-STOPTARGET [ MM](ACTIVE PROG...

  • Page 221

    Displays and GraphicsChapter 88-11Figure 8.9Results After Pressing {TARGET}(Small Display) SoftkeyPRGRAM A B STARGETD T G AXISSELECTTARGET[ MM]X-9999.647Y-3333.647Z-1111.647U-2222.647V-2222.647W-2222.647A-2222.647B-2222.647C-2222.647$X -2222.647$Y -2222.647$Z -2222.647F0.000 MMPMS00

  • Page 222

    Displays and GraphicsChapter 88-12{DTG}The distance from the current position to the command end point, of thecommanded axis in normal size characters.Figure 8.10Results After Pressing {DTG}SoftkeyE-STOPDISTANCE TO GO[ MM]F0.000 MMPMX0.021S00Z0.000T 0U0.000(ACTIVE PROGRAM NAME)MEMORYMANSTOPPRGRAM...

  • Page 223

    Displays and GraphicsChapter 88-13{DTG} (Large Display)The distance from current position to the command end point of thecommanded axis move in large characters.Figure 8.11Results After Pressing {DTG}(Large Display) SoftkeyPRGRAM A B STARGETD T G AXISSELECTDISTANCE TO GO[ MM](ACTIVE PROGRAM NAME)...

  • Page 224

    Displays and GraphicsChapter 88-14Figure 8.12Results After Pressing {DTG}(Small Display) SoftkeyPRGRAM A B STARGETD T G AXISSELECTDistance to Go[ MM]X0000.000Y0000.000Z0000.000U0000.000V0000.000W0000.000A0000.000B0000.000C0000.000$X 0000.000$Y 0000.000$Z 0000.000F0.000 MMPMS00

  • Page 225

    Displays and GraphicsChapter 88-15{AXIS SELECT}Important: {AXIS SELECT}is available only during a large characterdisplay or when more than 9 axes are displayed on a normal size display.When you press {AXIS SELECT}, the control displays the axis names in thesoftkey area. Press a specific axis lett...

  • Page 226

    Displays and GraphicsChapter 88-16{M CODE STATUS}The currently active M--codes are displayed. This screen indicates only thelast programmed M--code in the modal group. It is the PAL programmersresponsibility to make sure proper machine action takes place when theM--code is programmed.Figure 8.14R...

  • Page 227

    Displays and GraphicsChapter 88-17{PRGRAM DTG}This screen provides a multiple display of position information from theprogram screen and the distance to go screen.Figure 8.15Program, Distance to Go ScreenE-STOPPROGRAMDISTANCE TO GO[ MM ]X- 7483.647X0.031Y- 7483.647Y0.000Z- 7483.647Z0.000F0.000 MM...

  • Page 228

    Displays and GraphicsChapter 88-18{PRGRAM DTG} (Small Display)This screen provides a multiple display of position information from theprogram screen and the distance to go screen. It displays all system axes inthe active process (only available when more than 9 axis are AMPed in thesystem, or mor...

  • Page 229

    Displays and GraphicsChapter 88-19{ALL}This screen provides a multiple display of position information from theprogram, distance to go, absolute, and target screen. The all display isonly available on systems with 6 or less axes. On systems with more than6 axes, other combination screens are avai...

  • Page 230

    Displays and GraphicsChapter 88-20{G CODE STATUS}The currently active G-codes are displayed.Figure 8.18Results After Pressing {G CODE} SoftkeyPROGRAM STATUSPAGE 2 OF 2G50.1MIRROR IMAGE CONTROLG64CUTTING MODEG67MACRO CALL CANCELG70INCH PROGRAMMINGG80CANCEL OR END FIXED CYCLEG90ABSOLUTEG94FEED/MING...

  • Page 231

    Displays and GraphicsChapter 88-21{SPLIT ON/OFF}The split screen softkey is only available if your system installer haspurchased the dual-process option.When you press the {SPLIT ON/OFF}softkey, you can view informationfor both processes. The screen displays two 40-column screens on one80-column ...

  • Page 232

    Displays and GraphicsChapter 88-22A large screen display makes it easier for you to see the axes.E-STOPPRGRAMABSTARGET DTGAXISSELECTPROGRAM [MM]PROGRAM [MM]<FRONT TURRET><REAR TURRET>0.000X0.000X0.000ZF0.000IPMSOF0.000IPMSOIf desired the system installer has the option of configuring ...

  • Page 233

    Displays and GraphicsChapter 88-23If the parameter altered is used in the currently executing program block,that value will not be activated until the following block (unless a cuttercompensation value is being altered).If the parameter is altered in a block that is within the controls look ahead...

  • Page 234

    Displays and GraphicsChapter 88-249/240 CNCsThe 9/240 control is equipped to display four languages. The languagesavailable and the order they are displayed are fixed in this order:EnglishItalianJapaneseGermanQuickCheck and active program graphics function similarly. They bothplot tool paths. The...

  • Page 235

    Displays and GraphicsChapter 88-252.Select a program. Press {SELECT PRGRAM}.(softkey level 2)SELECTPRGRAMQUICKCHECKSTOPCHECKT PATHGRAPHT PATHDISABL3.Use the up and down cursors to select a program.4.Press {ACTIVE PRGRAM}to return to level 2 and activate the program.Follow these steps to run graph...

  • Page 236

    Displays and GraphicsChapter 88-26The control for both QuickCheck and active graphics continues to plot toolpaths, even if the graphics screen is not displayed. Actual display of thetool paths is only possible on the graphics screen. When the graphicsscreen is displayed again, any new tool motion...

  • Page 237

    Displays and GraphicsChapter 88-27In some cases, you may want to operate without graphics. For example,you cannot edit a part program using QuickView while in graphics, or youmay want to speed up processing by disabling graphics.To disable graphics, press the appropriate softkey:(softkey level 2)...

  • Page 238

    Displays and GraphicsChapter 88-28You may want to change the parameters to alter your graphics. If you wantto view a different graphics screen, you must change the default values forthe parameters. These are the default parameter values for QuickCheck:PROCESS SPEED:[FAST]RAPID TRAVERSE:[ON]AUTO S...

  • Page 239

    Displays and GraphicsChapter 88-292.Set Select Graph. Use the up and down cursor keys to select theaxes. Then set them by pressing the left or right cursor keys. Thedata for the selected axes change each time you press the left or rightcursor key.A pictorial representation of the selected graph, ...

  • Page 240

    Displays and GraphicsChapter 88-304.Set Auto Size. Use the up and down cursor keys to select theparameter. Set auto size by pressing the left or right cursor keys. Thevalue for the selected parameter changes each time you press the leftor right cursor key.If you turn this parameter “ON”, the ...

  • Page 241

    Displays and GraphicsChapter 88-317.Set the Main Program Sequence Starting #: parameter. It is onlyavailable with QuickCheck. Use the up and down cursors to selectthis parameter. Set it by typing in the new value for that parameterusing the keys on the operator panel. Press the [TRANSMIT]key when...

  • Page 242

    Displays and GraphicsChapter 88-329.Set the Process Speed parameter. It is only available withQuickCheck. Use the up and down cursors to select this parameter.Set it by pressing the left or right cursor keys. The data for theselected parameter changes each time you press the left or rightcursor k...

  • Page 243

    Displays and GraphicsChapter 88-33The active and QuickCheck graphics features can run in single-block orcontinuous mode as described in chapter 8.In:This happens:Single blockone block of a part program executes each time you press the<CYCLE START>.Continuous modethe control continues to exe...

  • Page 244

    Displays and GraphicsChapter 88-34Figure 8.19Zoom Window Graphic Display Screen.INCRWINDOWDECRWINDOWZOOMABORTZOOM20.015.611.16.72.2-2.2-6.7X-11.1-15.6-20.0-20.0-10.3 Z -0.59.218.927.738.448.157.9This screen resembles the regular QuickCheck graphics screen with theexception that it includes a wind...

  • Page 245

    Displays and GraphicsChapter 88-35To use the zoom window feature:1.Press the {ZOOM WINDOW}softkey. This changes the display to thezoom window display.(softkey level 3)CLEARGRAPHSMACHNEINFOZOOMWINDOWZOOMBACKGRAPHSETUP2.Use the cursor keys on the operator panel to move the center of thewindow aroun...

  • Page 246

    Displays and GraphicsChapter 88-363.To change the size of the window, use the {INCR WINDOW}or{DECR WINDOW}softkeys. To change the window size at a faster rate,press and hold the [SHIFT]key while pressing the {INCR WINDOW}or{DECR WINDOW}softkeys.Each time you press: The Zoom Window :{INCR WINDOW}i...

  • Page 247

    Displays and GraphicsChapter 88-37When power is turned on, the control displays the power turn-on screen .The following section discusses how to modify information displayed onthis screen at power up.Editing the System Integrator Message LinesTo edit the system integrator message lines of the pow...

  • Page 248

    Displays and GraphicsChapter 88-384.Press the {ENTER MESAGE}softkey. This highlights the softkey, andthe control displays the input prompt “PTO MESSAGE:” at the top ofthe screen. Also, the current text, if any, of the selected message lineis shown on the input line next to the prompt. (The te...

  • Page 249

    Displays and GraphicsChapter 88-39In the event that a system error or warning, PAL display page, PALmessage, or E-Stop condition occurs while the screen saver is active, thehorizontal scrolling line is replaced with a scrolling message “MESSAGEPENDING, PRESS A KEY TO DISPLAY.” The operator sh...

  • Page 250

    Displays and GraphicsChapter 88-40The screen saver setup screen appears.SCREEN SAVERACTIVATION TIMER : 05 MINUTESSAVERON/OFFINCRTIMERDECRTIMERPress This SoftkeyTo:SAVER ON/OFFtoggle between enabling and disabling the screen saver. When thesoftkey name is shown in reverse video, the screen saver i...

  • Page 251

    Chapter99-1CommunicationsThis chapter covers:TopicOn page:Communication port parameters9-3Inputting part programs from a tape reader9-9Outputting part programs to a tape punch9-13Verifying saved materials9-17Error conditions for inputting and outputting part programs9-18This section covers the co...

  • Page 252

    CommunicationsChapter 99-22.Press the {DEVICE SETUP}softkey to display the device setup screenas shown in Figure 9.1.(softkey level 2)PRGRAMPARAMAMPDEVICESETUPMONI-TORTIMEPARTSPTOMSI/OEMThe 9/230 CNC does not support port A. It uses only port B.Figure 9.1Device Setup ScreenE-STOPSERIAL PORT:ADEVI...

  • Page 253

    CommunicationsChapter 99-33.Use the up or down cursor keys to move the cursor to the parameterto be changed. The current value for each parameter will be shown inreverse video.Important: Select both the SERIAL PORT (A or B) and the DEVICEbeing set first (see Figure 9.1) since all other parameters...

  • Page 254

    CommunicationsChapter 99-4All of the following parameters can be set independently for eachcommunication port (A or B).DEVICE (setting type of peripheral)Select your peripheral device immediately after selecting your serial port.The devices with default communication parameters stored in the cont...

  • Page 255

    CommunicationsChapter 99-5PORT TYPEPort type options differ depending on the port you select.PortTypePort ARS232-CPort BRS232-C or RS422ABAUD RATEYou can set the baud rate at these speeds (in bits per second):300, 600, 1200, 2400, 4800, 9600, MAXMAXIMUM BAUD RATEIf you need to operate your 9/Seri...

  • Page 256

    CommunicationsChapter 99-6PROTOCOLSelect the protocol for communications from the following options.LEVEL_1LEVEL_2*DF1RAWPARITY (parity check)Select the parity from the following parity check schemes:ParityParity CheckNONENo parity checkEVENEven parityODDOdd paritySTOP BIT (number of stop bits)Se...

  • Page 257

    CommunicationsChapter 99-7OUTPUT CODESelect either EIA (RS-244A) or ASCII (RS-358-B) as output codes for 8bit data lengths. Selecting 7 bit data length sets this output code to “N/A”since EIA and ASCII do not apply to this type.AUTO FILENAMEThis parameter is valid only if you are inputting pa...

  • Page 258

    CommunicationsChapter 99-8STOP PRG ENDThis parameter is available only if you are reading a tape and have selecteda tape reader as your device (refer to DEVICE for details). It determines ifthe tape reader is to stop at the end of each program or continue readinguntil the end-of-tape code is reac...

  • Page 259

    CommunicationsChapter 99-9If “%” is set to “yes”, making it a valid program end-code, no programend-code other than PRGRM NAME can be set to “yes”. If anotherprogram end-code is set to “yes”, the “%” option is automatically set to“no”. Refer to the descriptions for M-codes...

  • Page 260

    CommunicationsChapter 99-10Figure 9.2Program Directory ScreenSELECTED PROGRAM:DIRECTORYPAGE1OF1NAMESIZECOMMENTO123451.3SUB TEST 1TEST3.9NEWMAIN1.3TTTE1.3THIS IS A TEST PROGRAMXXX1.35 FILES120.7METERS FREEACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAM3.Press the {COPY PRGRAM}softkey.REFO...

  • Page 261

    CommunicationsChapter 99-115.Select the device to copy from by using this table.If the peripheral device is connected to:Press this softkey:Port A{FROM A TO MEM}Port B{FROM B TO MEM}The screen is changes to the “COPY PARAMETERS” screen(Figure 9.3) and displays the current device and setup par...

  • Page 262

    CommunicationsChapter 99-12Input Multiple ProgramsPress {MULTI PRGRAM}to copy multiple programs from the tapeinto memory.If STOP PRG END was set tothe tape reader“yes”stops each time it encounters a program end ortape end code.“no”continuously reads programs until it encountersa tape end ...

  • Page 263

    CommunicationsChapter 99-13If a program is in control memory and you want to send a copy of thatprogram to a peripheral device, follow these steps:1.Verify that the peripheral device is connected to the correct serial portand that the port is configured for that device (refer to page 9-1).2.Press...

  • Page 264

    CommunicationsChapter 99-143.Press the {COPY PRGRAM}softkey.(softkey level 2)ACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMVERIFYPRGRAMPRGRAMCOMENTDELETEPRGRAMRENAMEPRGRAMINPUTDEVICEREFORMMEMORY4.Enter the program name to output from memory. There are two waysto do this:Type in the prog...

  • Page 265

    CommunicationsChapter 99-156.Specify if you want to output one, multiple, or all programs onto tape.Output Single ProgramPress {SINGLE PRGRAM}to output the program selected instep 4.Output Multiple ProgramsPress {MULTI PRGRAM}to output more than one program. Afteryou pressed the {MULTI PRGRAM}key...

  • Page 266

    CommunicationsChapter 99-16All programs are copied to the peripheral device and storedusing the same program name as the original, in the order thatthey appear on the Program Directory Screen.(softkey level 3)SINGLEPRGRAMMULTIPRGRAMOUTPUTALLFigure 9.5Copy Parameters ScreenCOPY PARAMETERSFROM:(Pro...

  • Page 267

    CommunicationsChapter 99-17To verify that a part program stored in memory matches a source programstored in memory or on a peripheral device:1.If one of the programs to either verify or verify against is on aperipheral device, make sure that the peripheral device is connectedto the correct serial...

  • Page 268

    CommunicationsChapter 99-185.To verify a part program in memory against a part program stored ona peripheral device, press the {VERIFY PORT A}or {VERIFY PORT B}softkey depending on where the peripheral device is connected.To verify a part program in memory against another part program inmemory, p...

  • Page 269

    Chapter1010-1Introduction to ProgrammingThe 9/Series control performs machining operations by executing a seriesof commands that make up a part program. These commands areinterpreted by the control which then directs axis motion, spindle rotation,tool selection, and other CNC functions.Part progr...

  • Page 270

    Introduction to ProgrammingChapter 1010-2Tape with Program End = M02, M30, M99This particular tape format allows single- or multi-program format on atape. It also lets you enter either M02, M30, or M99 as a program endcode. See chapter 10 for details on legal program end codes. Figure 10.1shows a...

  • Page 271

    Introduction to ProgrammingChapter 1010-3Tape with Program End = % (ASCII), ER (EIA)Unlike the previous tape type mentioned, this type of tape accepts only the“%” (ER) field as the program end code. See Figure 10.2. See chapter 10for details on legal program end codes and the effect of STOP P...

  • Page 272

    Introduction to ProgrammingChapter 1010-4(2) Leader SectionThe information between the tape start and the program start is called thetape leader section. The leader section is a tape indexing section. Onpunched tape, the holes punched in the leader section can be configured toshow alphanumeric ch...

  • Page 273

    Introduction to ProgrammingChapter 1010-5This section should include a program name, program blocks, comments,and end-of-program. Each block in the part program is separated by anEOB code. The control displays a semicolon “;” to indicate the presenceof an EOB code.Important: When performing a...

  • Page 274

    Introduction to ProgrammingChapter 1010-6(8) Tape End (Rewind, Stop Code)The tape end code, indicating the end of a tape, is designated with either:Code:Description:%ASCII formatEREIA formatEach individual machining operation performed by the control isdetermined by the control’s interpretation...

  • Page 275

    Introduction to ProgrammingChapter 1010-7A block is a set of words and characters that defines the operations of thecontrol. For example:/ N3 G00X10. Z10. M3 ;end of block charactermiscellaneous function word(spindle on forward)axis movement wordspreparatory function word(rapid positioning mode)s...

  • Page 276

    Introduction to ProgrammingChapter 1010-8You can enter up to 8 alphanumeric characters for program names.Subprograms are designated with the letter O followed by 5 numbers. Ifyou enter a new program name with 5 numeric characters, the controlassumes that it is a subprogram and automatically inser...

  • Page 277

    Introduction to ProgrammingChapter 1010-9Each block in a part program can be assigned a sequence number todistinguish one block from another. Sequence numbers begin with an Naddress, followed by a one to five digit numeric value.Sequence numbers can be assigned at random to specific blocks or to ...

  • Page 278

    Introduction to ProgrammingChapter 1010-10When you program a slash “/” followed by a numeric value (1-9)anywhere in a block, the control skips (does not execute) all remainingprogrammed commands. The block delete feature is turned on with the{FRONT PANEL} softkey or with an optionally install...

  • Page 279

    Introduction to ProgrammingChapter 1010-11All program blocks must have an end of block statement as the lastcharacter in the block. This character tells the control how to separate datainto blocks. The control uses the “;” to mark the end of a block.Important: When performing an EOB search, t...

  • Page 280

    Introduction to ProgrammingChapter 1010-12Generally, programs are executed sequentially. When you enter anM98Pnnnnn command (“nnnnn” representing a subprogram number) in aprogram, the control merges the subprogram (designated by the address P)before the block that immediately follows the M98 ...

  • Page 281

    Introduction to ProgrammingChapter 1010-13M99 code acts as a return command in both sub- and main programs;however, there are specific differences:Using M99 in a Main ProgramIf you use M99in a:M99:Main programexecutes all commands in the block, regardless if informationis programmed in the block ...

  • Page 282

    Introduction to ProgrammingChapter 1010-14Example 10.7Subprogram Calls and ReturnsMAIN PROGRAMSUBPROGRAM 1SUBPROGRAM 2(MAIN PROGRAM);(SUBPROGRAM 1);(SUBPROGRAM 2);N00010...;N00110;N00210;N00020...;N00120...;N00220...M99;N00030M98P1;N00130M99;N00040...;N00140...;N00050...;N00150M30;N00060M98P2L2;N...

  • Page 283

    Introduction to ProgrammingChapter 1010-15We use the term nesting to describe one program calling another. Theprogram called is a nested program. When a subprogram is called from themain program it is on the first nesting level or nesting level 1. If thatsubprogram in turn calls another subprogra...

  • Page 284

    Introduction to ProgrammingChapter 1010-16Words in a part program consist of addresses and numeric values.Component:Description:AddressA character to designate the assigned word function.Numeric valueA numeral to express the event called out by the word.Figure 10.4Word ConfigurationWordWordG 0 1X...

  • Page 285

    Introduction to ProgrammingChapter 1010-17Table 10.A shows the effects of leading zero suppression (LZS) andtrailing zero suppression (TZS). It presumes that your system installer hasset a format of X5.2 (integer 5 digits, decimal 2 digits) in AMP. Differentformats would result in different decim...

  • Page 286

    Introduction to ProgrammingChapter 1010-18Important: If backing up a table using a G10 program (such as the offsettables or coordinate system tables), keep in mind the G10 program outputis generated in the current format of the control (LZS or TZS). If youintend to transport this table to a diffe...

  • Page 287

    Introduction to ProgrammingChapter 1010-19Table 10.BWord Formats and DescriptionsAddressValidRangeinchValidRangemetricFunctionA8.63.38.53.3Rotary axis about X (AMP assigned)Angle in QuickPath Plus programmingB3.03.0Second miscellaneous function (AMP assigned)C8.68.68.58.5Rotary axis about Z (AMP ...

  • Page 288

    Introduction to ProgrammingChapter 1010-20The maximum programmable value accepted by the control is 99,999,999.The minimum is .000001 inch or .00001mm. The actual range ofprogrammable values depends on specifications determined by yoursystem installer.By using AMP to establish the format of numer...

  • Page 289

    Introduction to ProgrammingChapter 1010-21To simplify programming an angle, corner radius, or chamfer between twolines, all that is necessary is the angle between the lines and the radius orchamfer size connecting them. This method of programming can be usedto simplify the cutting of many complex...

  • Page 290

    Introduction to ProgrammingChapter 1010-22Feedrates are expressed by the distance of movement per interval.Depending on the mode of the control and the results you want, thedistance can be millimeters, inches, meters, or revolutions. The intervalcan be minutes or revolutions.Table 10.DFeedrate Un...

  • Page 291

    Introduction to ProgrammingChapter 1010-23Important: G-codes can also be expressed in terms of a parametricexpression (for example G[#12+6]). For details, see chapter 28.Example 10.8 explains execution of modal G-codes, using G00 and G01,both classified into the same G-code group.Example 10.8Prog...

  • Page 292

    Introduction to ProgrammingChapter 1010-24Table 10.EG-code TableABCModalFunctionTypeG0001Rapid PositioningModalG01Linear InterpolationG02Circular Interpolation (Clockwise)G03Circular Interpolation (Counterclockwise)G0400DwellNon-ModalG05Send Command and Wait for Return Status(used with 9/Series D...

  • Page 293

    Introduction to ProgrammingChapter 1010-25Table 10.E (continued)G-code TableABCModalFunctionTypeG2700Machine Home Return CheckNon-ModalG28Automatic Return to Machine HomeG29Automatic Return from Machine HomeG30Return to Secondary homeG31External Skip Function 1G31.1External Skip Function 1G31.2Ex...

  • Page 294

    Introduction to ProgrammingChapter 1010-26Table 10.E (continued)G-code TableABCModalFunctionTypeG59.2Preset Work Coordinate System 8G59.3Preset Work Coordinate System 9G6113Exact Stop ModeModalG62Automatic Corner OverrideG63Tapping ModeG64Cutting ModeG6500Paramacro CallNon-ModalG6614Paramacro cal...

  • Page 295

    Introduction to ProgrammingChapter 1010-27Table 10.E (continued)G-code TableABCModalFunctionTypeG99G95G95Feed per revolution modeG9617CSS ONModalG97RPM Spindle Speed Mode----G98G9810Initial level return drilling cyclesModal----G99G99R-point level return drilling cyclesA set of default G-codes bec...

  • Page 296

    Introduction to ProgrammingChapter 1010-28execute after the axis motion is completedThis order of execution can also be altered by using the paramacro feature,system parameter #3003. See chapter 28.Your system installer determines in AMP if M- and G-codes get resetevery time the control executes ...

  • Page 297

    Introduction to ProgrammingChapter 1010-29Table 10.FM-codesM-codeNumberModal orNon-modalGroupNumberFunctionM00NM4Program stopM01NM4Optional program stopM02NM4Program endM30NM4Program end and reset (tape rewind)PRIMARY SPINDLEM03M7Spindle positive rotation (cw)M04M7Spindle negative rotation (ccw)M...

  • Page 298

    Introduction to ProgrammingChapter 1010-30(1) Program Stop (M00)When you execute M00, execution stops after the block containing theM00 is executed. At this time, the CRT displays the “PROG STOP”message. To restart the operation, press the <CYCLE START> button.(2) Optional Program Stop ...

  • Page 299

    Introduction to ProgrammingChapter 1010-31(5) Overrides Enabled (M48)When your execute M48, the feedrate override, rapid feedrate override,and the spindle speed override functions become effective. These areenabled on power up without requiring this M code to be executed. AnM48 cancels an M49 and...

  • Page 300

    Introduction to ProgrammingChapter 1010-32(10) End of Subprogram or Main Program Auto Start (M99)M99 End of Subprogram or Paramacro programWhen you execute M99, subprogram execution is completed andprogram execution returns to the calling program. This word is notvalid in an MDI command, but it c...

  • Page 301

    Introduction to ProgrammingChapter 1010-33(12) Synchronization with Setup (M150-M199)M150 - M199 — Synchronization with Setup(dual-process system only)This set of M-codes cancels any information already in block lookahead and re-setup the blocks before process execution is resumed.This re-setup...

  • Page 302

    Introduction to ProgrammingChapter 1010-34The O-word is used to define a program name. To use an O word as aprogram name it must be the first block entered in a program. This blockcan be used to identify a program when reading from a tape (whenprogram name is selected as “automatic” from the ...

  • Page 303

    Introduction to ProgrammingChapter 1010-35Important: Your system installer sets a maximum speed in AMP for eachgear range for each spindle configured in AMP. If an S-word isprogrammed requesting a spindle speed that exceeds this limit. Thespindle speed holds at the AMP-defined maximum. A new valu...

  • Page 304

    Introduction to ProgrammingChapter 1010-36Modern machining processes usually require a machine that is capable ofselecting different tools. Typically tools are mounted in a turret andassigned tool numbers as illustrated in Figure 10.6.Figure 10.6Typical Tool Turret0708010203040506These data are s...

  • Page 305

    Introduction to ProgrammingChapter 1010-37Table 10.GT-word FormatsFormat TypeWear Offset #Geometry Offset #(1) 1 DGT GEOM + WEARlast digitsame as wear(2) 2 DGT GEOM + WEARlast two digitssame as wear #(3) 3 DGT GEOM + WEARlast three digitssame as wear #(4) 1 DGT WEARlast digitsame as tool #(5) 2 D...

  • Page 306

    Introduction to ProgrammingChapter 1010-38

  • Page 307

    Chapter1111-1Coordinate System OffsetsThis chapter covers the control of the coordinate systems on the 9/Seriescontrol. G-words in this chapter are among the first programmed becausethey define the coordinate systems of the machine in which axis motion isprogrammed. This chapter describes:Informa...

  • Page 308

    Coordinate System OffsetsChapter 1111-2Once you establish, the machine coordinate system is not affected by acontrol reset operation or any other programming or operator operation.Figure 11.1Machine Coordinate System, Home Coordinate AssignmentChuckMachine Coordinate Systemzero point+Z+XMechanica...

  • Page 309

    Chapter 11Coordinate System Offsets11-3Although axis motion is usually commanded in the work coordinatesystem, axis motion is possible when a G53 is programmed in a block ifyou reference coordinate values in the machine coordinate system.G90G53X___Z___;The X- and Z-words above specify coordinate ...

  • Page 310

    Coordinate System OffsetsChapter 1111-4Figure 11.2Results of Example 12.1N2N3N1Work coordinate systemMachine coordinate systemAxis motion in machinecoordinate systemAxis motion in workcoordinate systemXXZZ1020304050607080305050403020103020When you cut a workpiece using a part program made from a ...

  • Page 311

    Chapter 11Coordinate System Offsets11-5Figure 11.3Work Coordinate SystemZero point onthe part drawingWorkpieceChuckWorkpieceZero point on the workcoordinate systemTool position atmachine coordinate zero pointZ Distance to be designatedX Distance to be designatedThere are 7 preset work coordinate ...

  • Page 312

    Coordinate System OffsetsChapter 1111-6Figure 11.4Work Coordinate System DefinitionMachine coordinate systemMachine homeG54 Work coordinate system2-3-23XXZZIn Figure 11.4, the machine coordinate system was defined by declaringthe fixed position machine home as the point X=-3., Z=-2. Then the G54w...

  • Page 313

    Chapter 11Coordinate System Offsets11-7To change work coordinate systems, specify the G-code corresponding tothe work coordinate system you want in a program block. Any axismotion commands in a block that contains a change from one workcoordinate system to another is executed in the work coordina...

  • Page 314

    Coordinate System OffsetsChapter 1111-8The third method, and the one described in this section, alters the workcoordinate system table through G10 programming. Changing the valuesin the table using any of these methods does not cause axis motion. It doesimmediately shift the active coordinate sys...

  • Page 315

    Chapter 11Coordinate System Offsets11-9Example 11.3Work Coordinate System Shift Using G10Program blockWork coordinate PositionAbsolute coord. PositionG54G01X25.Z25.;G91;G10L2P1O2X10.Z10.;X25 Z25X15 Z15X50 Z45X50 Z45orG54G01X25.Z25.;G90;G10L2P1O2X35.Z30.;X25 Z25X15 Z15X50 Z45X50 Z45Important: This...

  • Page 316

    Coordinate System OffsetsChapter 1111-10The external offset allows all work coordinate system zero points to beshifted simultaneously, relative to the machine coordinate system. Thisoffset can compensate for part positioning shifts that result when adifferent chuck is installed. It can also compe...

  • Page 317

    Chapter 11Coordinate System Offsets11-11There are 3 methods to change the value of an external offset in the workcoordinate system table. Two methods can be found in the followingsections:Method:Chapter:manually alter the external offset value in the workcoordinate system table3alter the paramacr...

  • Page 318

    Coordinate System OffsetsChapter 1111-12Example 11.4Changing the External Offset Through G10 ProgrammingProgram BlockCommentsG10L2P1O1X-15.Z-10.;defines work coordinate system zeropoint to be at X-15, Z-10 from themachine coordinate system zero pointG90;G10L2P0O1X-15.Z-20.;sets external offset of...

  • Page 319

    Chapter 11Coordinate System Offsets11-13This section describes the more temporary ways of offsetting the workcoordinate systems. These offsets are activated through programming, andthey are canceled when you remove power to the control. They may alsobe cancelled by an M02, M30, or control reset, ...

  • Page 320

    Coordinate System OffsetsChapter 1111-14For example specifying values of zero for all axes in a G92 block causesthe current tool position to become the zero point of the current workcoordinate system.Execution of a G92 block does not produce any axis motion.Important: Any axis not specified in th...

  • Page 321

    Chapter 11Coordinate System Offsets11-15Figure 11.10Results of Example 12.5Machine coordinate system zero pointZero point for the G54work coordinate systemNew zero point establishedby the G92 block102030103020Tool positionZZXXCAUTION: G92 offsets are global. Changing from onecoordinate system to ...

  • Page 322

    Coordinate System OffsetsChapter 1111-16Example 11.6Changing Work Coordinate Systems With Offset ActiveProgramCommentN1 G10L2P1X0Z0;Define G54 work coordinate system zero point to bepositioned X0, Z0 away from the machinecoordinate systemN2 G10L2P2X20.Z25.;Define G55 work coordinate system zero p...

  • Page 323

    Chapter 11Coordinate System Offsets11-17To offset a work coordinate system an incremental amount from its zeropoint, program a G52 block that includes the axis names and distances tobe offset.G52 X___ Z___ ;This command offsets the current work coordinate system by the axisvalues that follow the ...

  • Page 324

    Coordinate System OffsetsChapter 1111-18A G52 offset can also be canceled by executing a G92 or G92.1,performing a control reset or an E-STOP reset operation, or executing anend of program M30 or M02. A G92 command only cancels a G52 offsetif one is active when the G92 block is executed. A G52 of...

  • Page 325

    Chapter 11Coordinate System Offsets11-19Example 11.8Typical Set Zero Offset ApplicationOperationComment-Manual jog-axes are manually jogged to a location where the operator hasdetermined that a special operation must be performed.-Set Zero-operator performs a Set Zero offset to establish the work...

  • Page 326

    Coordinate System OffsetsChapter 1111-20To use this feature, follow these steps:1.Press <CYCLE STOP> or <SINGLE BLOCK> on the MTB panel tointerrupt automatic or MDI operation.2.Turn on the switch to activate the jog offset feature (refer todocumentation provided by your system install...

  • Page 327

    Chapter 11Coordinate System Offsets11-21Example 11.9 demonstrates the G92.1 offset cancel.Example 11.9G52 Offset Cancelled By a G92.1Program BlocksCommentN1 G01Y25.X25.;move to Y25, X25N2 G52Y10.X10.;work coordinate system is offset by Y10, X10N3 Y25.X25.;move to Y25, X25 in the offset coordinate...

  • Page 328

    Coordinate System OffsetsChapter 1111-22The G92.2 block must be programmed with no axis words. Axis words ina G92.2 block generate an error. When you execute the G92.2 block, allG92, {SET ZERO}, and Jog offsets are canceled on all axes. You cannotcancel the offsets on only one or more of the axes...

  • Page 329

    Chapter1212-1Overtravels and Programmable ZonesOvertravels and programmable zones define areas that restrict the movablerange of the cutting tool. The 9/Series control is equipped to establish twoovertravel areas and two programmable zones as illustrated in Figure 12.1.Topic:On page:Hardware over...

  • Page 330

    Overtravels and Programmable ZonesChapter 1212-2There are two types of overtravels:Hardware overtravels ---- Established by your system installer bymounting mechanical limit switches on the movable range of the axesSoftware overtravels ---- Established in AMP by your system installerdesignating c...

  • Page 331

    Chapter 12Overtravels and Programmable Zones12-3The coordinate values of the points defining the software overtravels areset in AMP by your system installer. This overtravel can only be disabledby your system installer in AMP. If your system installer has enabled thesoftware overtravels, the cont...

  • Page 332

    Overtravels and Programmable ZonesChapter 1212-4Figure 12.3Area Defining Software OvertravelMax XvalueMin XvalueMin ZvalueMax ZvalueSoftware overtravel area as defined in AMP by minimum andmaximum axis valuesMachinecoordinatezeroXZTypically the software overtravels are located within the hardware...

  • Page 333

    Chapter 12Overtravels and Programmable Zones12-5Programmable zone 2 defines an area which the tool cannot enter.Generally, zones are used to protect some vital area of the machine or partlocated within the software overtravels.Important: Programmable zones are defined using coordinates in themach...

  • Page 334

    Overtravels and Programmable ZonesChapter 1212-6Programmingthis G-code:turns Zone 2:turns Zone 3:G22OnOnG22.1OffOnG23OffOffG23.1No Change*Off* A G23.1 turns on programmable zone 2 if it is the defaultpower up condition configured in AMP (also activated at acontrol reset). G23.1 does not turn on p...

  • Page 335

    Chapter 12Overtravels and Programmable Zones12-7Figure 12.5Programmable Zone 2Software overtravelProgrammableZone 2Tool tip can notenter zone 2For details on how the control reacts to entry into a prohibited area, seepage 12-13.Programmable zone 3 can define an area which the tool cannot enter or...

  • Page 336

    Overtravels and Programmable ZonesChapter 1212-8Values for programmable zone 3 are entered either in the programmablezone table (described on page NO TAG) or through a G22 program block.A maximum and a minimum coordinate value (in the machine coordinatesystem) are assigned for each axis. The resu...

  • Page 337

    Chapter 12Overtravels and Programmable Zones12-9Figure 12.7Programmable Zone 3This area becomes ProgrammableZone 3 if the zone is enabledwhen tool is inside of this areaProgrammable Zone 3if enabled when toolis outside of this areaProgrammable zone 3 becomes active when either the G22 or G22.1 co...

  • Page 338

    Overtravels and Programmable ZonesChapter 1212-10If you program other commands other than a G-code in the same modalgroup in a G22, G22.1, G23, or G23.1 block, this error message appears:“UNNECESSARY WORDS IN ZONE BLOCK”Programming zone 3 values (3 or less axes)You can reassign values for the...

  • Page 339

    Chapter 12Overtravels and Programmable Zones12-11If a value for a maximum axis parameter is less than the value set for anaxis current minimum parameter, or if a value for a minimum axisparameter is set greater than the value set for an axis current maximumvalue, the control displays the message:...

  • Page 340

    Overtravels and Programmable ZonesChapter 1212-12Using this method, the same integrand word assigned in AMP to more thanone axis correspond only to the absolute axis words programmed in theG22 block. Integrand words cannot be programmed alone (without aabsolute axis word in the G22 block). The fo...

  • Page 341

    Chapter 12Overtravels and Programmable Zones12-13Tool motion stops during overtravel conditions that occur from 3 causes:Cause:Description:Hardware overtravelthe axes reach a travel limit, usually set by a limit switch or sensormounted on the axis. Hardware overtravels are always active.Software ...

  • Page 342

    Overtravels and Programmable ZonesChapter 1212-14

  • Page 343

    Chapter1313-1Coordinate ControlThis chapter describes 9/Series coordinate control.For information about:See page:Plane selection G17, G18,G1913-1Absolute/Incremental modes G90, G9113-2Inch/Metric modes G70, G7113-4Radius/Diameter modes G07, G0813-5Scaling G14, G14.113-7The 9/Series control has a ...

  • Page 344

    Coordinate ControlChapter 1313-2Example 13.1Altering Planes for Parallel AxesAssuming the system installer has made the following assignments in AMP:G18-- the ZX plane.U axis -- parallel to Z axisV axis -- parallel to X axisProgram blockPlane selectedAxis MotionG18;selects ZX planeNoneG18 U0;sele...

  • Page 345

    Chapter 13Coordinate Control13-3In the above block, the control moves the cutting tool away from thecurrent axis position, a distance of 40 units on the X axis and 20 units onthe Z axis.G91 is a modal G-code and remains active until cancelled by a G90.Example 13.2Absolute vs Incremental CommandsA...

  • Page 346

    Coordinate ControlChapter 1313-4To program incremental moves using G-code system A, call out axispositions using U, W, and V.Incremental command, G code system AU20.W-25.;The above commands are not modal. Incremental and absolute commandscan be programmed at any time, even in the same block.Table...

  • Page 347

    Chapter 13Coordinate Control13-5Usually, workpieces on CNC lathes are cylindrical. The control allowsworkpiece dimensions programming as either radius or diameter values.G08 places the control in diameter programming mode. This moderemains active until cancelled by a G07.G07 places the control in...

  • Page 348

    Coordinate ControlChapter 1313-6Figure 13.2Diameter/Radius ProgrammingX10155ZDiameterRadiusProgrammingProgrammingMode (G08)Mode (G07)G90G08X12.; G90G07X6ororG91G08X-8.; G91G07X-4.;6121020Important: The following must always be programmed as radius value,regardless of whether G07 or G08 is active:...

  • Page 349

    Chapter 13Coordinate Control13-7Use the scaling feature to reduce or enlarge a programmed shape. Enablethis feature by programming a G14.1 block as shown below:G14.1 X__ Z__ P__;Where :Is :X and Zthe axis or axes to be scaled and the center of scaling for those axes.Pthe scaling magnification fac...

  • Page 350

    Coordinate ControlChapter 1313-8Figure 13.3Results of Example 13.4Original part contourContour after scalingX axis only by .5 inG90 absolute mode6ZX102030204060When incremental mode (G91) is active, the control ignores theprogrammed centers of scaling. The control performs scaling on the axesprog...

  • Page 351

    Chapter 13Coordinate Control13-9Figure 13.4Results of Example 13.5Original part contourContour after scalingX axis only by .5 inG91 incremental mode--9ZX102030204060G14 disables scaling on all axes. When you disable scaling, the center ofscaling and any scaling magnification factors are cleared. ...

  • Page 352

    Coordinate ControlChapter 1313-10When you enable scaling for a particular axis, the letter “P” is displayednext to the axis name on all axis position display screens. Figure 13.5shows scaling enabled on all axes.Figure 13.5Axis Position Display Screen Showing Scaling EnabledE-STOPPROGRAM[ MM]...

  • Page 353

    Chapter 13Coordinate Control13-11To access the scaling magnification data screen, follow these steps:1.Press the {OFFSET} softkey on the main menu screen.(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTFRONTPANELERRORMESAGEPASS-WORDSWITCHLANG2.Press the {SCALNG} softkey to di...

  • Page 354

    Coordinate ControlChapter 1313-12Important: If an axis is configured as a rotary axis, the scalingmagnification display screen displays dashes instead of numbers for thataxis. Rotary axes cannot be scaled.The left column lists the current center of scaling for each axis.When scaling is cancelled,...

  • Page 355

    Chapter 13Coordinate Control13-13When changing work coordinates (G54-G59.3), the center of scaling istransferred from the old work coordinate system to the new workcoordinate system. The offset distance from the tool position in the oldwork coordinate system to the tool position in the new work c...

  • Page 356

    Coordinate ControlChapter 1313-14G37, G37.1 - G37.4Gxx Z__Z (scaled)G73, G74, G76, G82, G83, G84G85, G86, G87, G88, G89Gxx X__ Y__ Z__R__I__Q__K__P__F__L__X (scaled)Y (scaled)Z (scaled)R (scaled)I (not scaled)Q (not scaled)K (not scaled)P (not scaled)F (not scaled)L (not scaled)Important: R uses ...

  • Page 357

    Chapter 13Coordinate Control13-15G78G78 X__Z__K__D__F__E__A__P__I__X (scaled)Z (scaled)K (not scaled)D (not scaled)F (not scaled)E (not scaled)A (not scaled)P (not scaled)I (scaled)G33G33 Z_F_E_QG33 X_Z_F_E_QG33 X_F_E_QX (scaled)Z (scaled)E (not scaled)F (not scaled)Q (not scaled)G34G34 Z_F_E_Q K...

  • Page 358

    Coordinate ControlChapter 1313-16CAUTION: This cycle cuts more metal when scaling isenabled.G21G21 X_Z_F_E_X (scaled)Z (scaled)F (not scaled)E (not scaled)G24G24 X_Z_K_X (scaled)Z (scaled)K (scaled)CAUTION: This cycle cuts more metal when scaling isenabled.G81G81 X_Z_R F_L_X (scaled)Z (scaled)R (...

  • Page 359

    Chapter1414-1Axis MotionThis chapter covers the group of G-words that generates axis motion ordwell data blocks. Major topics include:Information about:On page:Positioning axes14-1Automatic machine home14-12Dwell (G04)14-18Programmable mirror image14-19Axis clamp14-22Use these 4 basic G-codes to ...

  • Page 360

    Axis MotionChapter 1414-2Your system installer determines the feedrate for the rapid positioningmode in AMP, individually for each axis. The feedrate of a positioningmove that drives more than one axis is limited by the rapid rate set for theslower axis. The slower axis is driven at its rapid rat...

  • Page 361

    Axis MotionChapter 1414-3The format for linear interpolation mode is:G01X ____Z ____ F ____ ;Where :Is :G01G01 establishes the linear interpolation mode. In linear interpolation mode, thecutting tool is fed along a straight line at the currently programmed feedrate.XZThis is the location of the e...

  • Page 362

    Axis MotionChapter 1414-4Once the feedrate, F, is programmed it remains effective until anotherfeedrate is programmed (F is modal). You can override programmedF-words. For details, see chapter 18.Example 14.3Modal FeedratesProgram BlockCommentG91G01X10.Z20.F.1;F.1 is effective untilZ35.;another f...

  • Page 363

    Axis MotionChapter 1414-5You must establish a plane before the control performs the correct arc.This should have been done by your system installer, typically assigningthe Z and X axes to the G18 plane. This becomes the default plane that thecontrol assumes when:power is turned onE-Stop is resett...

  • Page 364

    Axis MotionChapter 1414-6Example 14.4Circular Interpolation G18 (ZX Plane)Absolute ModeIncremental ModeG08G02;X50.Z45.I15.K0F.1;G08G02;X30.Z-15.I15.K0F.1;ororG08G02;X50.Z45.R15.F.1;G08G02;X30.Z-15.R15.F.1;In Example 14.4, the K-word can be omitted. If either I or K is omittedfrom the circular blo...

  • Page 365

    Axis MotionChapter 1414-7Example 14.5Arc Programmed Using RadiusArc 1Arc 2center angle less thancenter angle greater than180 degrees180 degreesG90G02X25.Z40.R18.F.1;G90G02X25.Z40.R-18.F.1;Figure 14.5Results of An Arc Programmed with Radius Command, Example 14.5R-18startpointArc 1R18end pointArc 2...

  • Page 366

    Axis MotionChapter 1414-8Example 14.6Arc End Points Same As Start PointsArc 1-Full CircleArc 2-No MotionG02I-5.K5.F.1;G02R7.07F.1;ororG02X15.Z5.I-5.K5.F.1;G02X15.Z5.R7.07F.1;Figure 14.6Results of An Arc with End Point Equal To Start Point, Example 14.6Full circleArc 10 degree center angle arc(no ...

  • Page 367

    Axis MotionChapter 1414-9This section describes how to program a rotary axis. A rotary axis is anon-linear axis that typically rotates about a fixed point. A rotary axis isnot the same as a spindle which uses an M19 to orient to a specific angle.A spindle orient (M19) cannot move simultaneously w...

  • Page 368

    Axis MotionChapter 1414-10In incremental mode (G91), the rotary axis is programmed to move in anangular distance (not to a specified angle as in absolute). The maximumincremental departure depends on the programming format selected inAMP by your system installer. The sign of the angle determines ...

  • Page 369

    Axis MotionChapter 1414-11Determining Rotary Axis FeedratesThe feedrate for a rotary axis is determined in much the same way as linearaxes.When the control is in rapid mode (G00), the feedrate for the rotary axis isthe rapid feedrate for that axis as set in AMP. Remember that if other axesare mov...

  • Page 370

    Axis MotionChapter 1414-12Machine tools have a fixed machine home position that is used to establishthe coordinate systems. The 9/Series control offers two methods forhoming a machine after power up.Operation:Description:Manual machine homeuses switches or buttons on the MTB panel provided solely...

  • Page 371

    Axis MotionChapter 1414-132.When the output command equals 0 (i.e., the axis stops), the controlwill determine the absolute position. Refer to your AMP manual formore information about DCM Homing for Absolute Position.If your axis is already homed, refer to the Automatic Return toHome (G28) secti...

  • Page 372

    Axis MotionChapter 1414-14Figure 14.7Automatic Return to Machine Home (G28)ZIntermediate pointMachine homeUsually a G28 is followed by a G29 (automatic return from machinehome) in a part program; however, the control stores the intermediate pointin memory for use with any subsequent G29 block exe...

  • Page 373

    Axis MotionChapter 1414-15When a G29 is executed in a part program (or through MDI), the axis oraxes move first to the intermediate point, and then to the position indicatedin the G29 block. If a G28 was just executed, then this has the effect ofreturning the axis from machine home.For example, e...

  • Page 374

    Axis MotionChapter 1414-16Figure 14.8Automatic Return From Machine Home, Results of Example 14.7XZ5010015020050100150200N10N20N30N30N40Machine homeImportant: When a G29 is executed, tool offsets and/or cuttercompensation are deactivated on the way to the intermediate point, andthey are re-activat...

  • Page 375

    Axis MotionChapter 1414-17If an attempt is made to execute a G27 before the axes have been homed,the control goes to cycle stop and displays this error message:“MACHINE HOME REQUIRED OR G28”The G30 command is similar to the G28 command. The main difference isthe axis or axes move to an altern...

  • Page 376

    Axis MotionChapter 1414-18Important: When the control executes a G28 or G30 block, it temporarilyremoves any tool offsets and cutter compensation during the axis move tothe intermediate point. The offsets and/or cutter compensation areautomatically re-activated during the first block containing a...

  • Page 377

    Axis MotionChapter 1414-19In the G95 mode (feed per revolution), G04 suspends execution ofcommands in the next block for the time it takes the controlling spindle toturn a designated number of revolutions.G95G04P__;X__;U__;Specify the required dwell length by either a P-, X-, or U-word in units o...

  • Page 378

    Axis MotionChapter 1414-20The control only cancels the mirror feature for those axes that areprogrammed in the G50.1 block. Axes not programmed in the G50.1 blockremain mirrored. There is no significance to the values programmed withthe axis words in a G50.1 block. Axis values might not be requir...

  • Page 379

    Axis MotionChapter 1414-21Figure 14.9Programmable Mirror Image, Results of Example 14.812090756030Start pointEnd point012090756030XZWhen the mirror image function is active on only one of a pair of axes, thecontrol:executes a reverse of programmed G02/G03 arcs. G02 becomescounterclockwise and G03...

  • Page 380

    Axis MotionChapter 1414-22Your system installer can install a switch for each of the 4 available axes.What axes are mirrored with what switches depends on the PAL programin your system. You can mirror about more then one axis using more thenone manual mirror image switch at the same time or one s...

  • Page 381

    Chapter1515-1Using QuickPath PlusäThe QuickPath Plus feature offers a convenient programming method tosimplify programming with the 9/Series control.We discuss some QuickPath Plus features in this chapter. Major topicsinclude:Topic:On page:Programming15-2Linear QuickPath15-3Circular QuickPath15-...

  • Page 382

    Using QuickPath PlusChapter 1515-2When programming QuickPath Plus, remember:Any axis words that are programmed must be in the current plane, andangles are measured from the first axis defining that plane. Allexamples in this section assume that the ZX plane is active (angles aremeasured relative ...

  • Page 383

    Using QuickPath PlusChapter 1515-3If an angle is programmed in a circular QuickPath Plus block, an error isgenerated.If an L-word is programmed in a G13, or G13.1 block an error isgenerated.One End CoordinateMany times part drawings give a programmer only one axis dimension fora tool path and req...

  • Page 384

    Using QuickPath PlusChapter 1515-4Example 15.1Angle Designation:N10 GO1 X0.0 Z25.0 F.1.;N20 X15. ,A90;N30 Z5.,A165;Figure 15.1Results of Angle Designation, Example 15.1XZ510 15 20 25151050165°Important: Circular QuickPath Plus can also use an angle (,A) in aprogram block. This is described in se...

  • Page 385

    Using QuickPath PlusChapter 1515-5Important: If any axis word from the current plane is designated in theblock, the L-word is ignored and the control calculates the end point fromthe angle and the axis word. If an angle (,A) or a length (L) isprogrammed in a block that also contains both axis wor...

  • Page 386

    Using QuickPath PlusChapter 1515-6The format for these blocks is:N1 ,A__;N2 ,A__Z__X__;Where :Is :,AAngleThis word is used to define the angle of a tool path. This manualassumes that the ,A-word is used. The angle is a positive value whenmeasured counterclockwise from the first axis defining the ...

  • Page 387

    Using QuickPath PlusChapter 1515-7The programmer uses the Circular QuickPath when a drawing does not callout the actual intersection of two consecutive tool paths and at least one ofthe tool paths is circular. This prevents the programmer from having to doany complex calculations to determine end...

  • Page 388

    Using QuickPath PlusChapter 1515-8Linear to Circular blocksWhen the coordinates of the intersection of a linear path into a circularpath are unknown, use the following format. G13 or G13.1 must beprogrammed. These blocks must be programmed in absolute.Format:G13G01 ,A__;orG13G01 ,A__;G02 Z__X__K_...

  • Page 389

    Using QuickPath PlusChapter 1515-9Circular to Linear blocksWhen the coordinates of the intersection of a circular path into a linearpath are unknown, use the following format. G13 or G13.1 must beprogrammed in the first of the two blocks. These blocks must beprogrammed in absolute.Format:G13G02I_...

  • Page 390

    Using QuickPath PlusChapter 1515-10Circular to Circular blocksWhen the coordinates of the point of intersection of a circular path into acircular path are unknown, use the following format. G13 or G13.1 mustbe programmed. If using this format, the R-word cannot be used tospecify the radius of an ...

  • Page 391

    Chapter1616-1Chamfering and Corner RadiusDuring cornering, the 9/Series control has the option of performing either achamfer (a linear transition between the blocks) or a corner radius (an arctransition between blocks).,CChamfer sizeThis word is used to define a chamfer length that connects twoin...

  • Page 392

    Chamfering and Corner RadiusChapter 1616-2There is a limit of 4 non-motion blocks allowed between the first andsecond motion blocks defining the corner transition. A non-motion blockis any block that does not generate axis motion in the currently activeplane. The control generates an error if mor...

  • Page 393

    Chamfering and Corner RadiusChapter 1616-3Figure 16.1Results of Chamfering Using ,C from Example 16.1XZ2.020.0Example 16.2Linear to Circular Motions with ChamferN10X0.Z0.F.1;N20X10.Z10.,C5;N30G02X20.Z20.R10;Figure 16.2Results of Linear to Circular Motions with Chamfer, Example 16.2Actual start po...

  • Page 394

    Chamfering and Corner RadiusChapter 1616-4Use the ,R command to program a radius between two intersecting toolpaths. The R command must be programmed after a comma (,). Programthe ,R followed by the radius size in the block where the first path isprogrammed. The control looks ahead to the block c...

  • Page 395

    Chamfering and Corner RadiusChapter 1616-5Figure 16.3Results of Radius for a Circular Path into a Linear path, Example 16.3ZX30252015105252015105Actual start point ofblock N30 and endpoint of corner blockProgrammed endpoint of block N20Actual end point ofblock N20 and startpoint of corner blockCo...

  • Page 396

    Chamfering and Corner RadiusChapter 1616-6Figure 16.4Results of Radius and Chamfer, Example 16.4XZ40.020.02.0R 5.010.020.05.0When using chamfering and corner radius, remember:If the control is executing in single block mode, the control enters thecycle stop state after executing the first block a...

  • Page 397

    Chamfering and Corner RadiusChapter 1616-7You must program ,C and ,R in blocks that contain axis motion in thecurrent plane. If they are programmed in a block that does not containaxis motion in the currently active plane, the control generates an error.,C and ,R cannot be programmed in a block t...

  • Page 398

    Chamfering and Corner RadiusChapter 1616-8

  • Page 399

    Chapter1717-1SpindlesThis chapter describes spindle speed control, orientation, and direction, andthe virtual C axis.Topic:See page:Spindle Speed Control17-1Controlling Spindles (G12.1, G12.2, G12.3)17-9Spindle Orientation (M19, M19.2, M19.3)17-10Spindle Direction (M03, M04, M05)17-12Virtual C Ax...

  • Page 400

    SpindlesChapter 1717-2In this case, cutting speed V is expressed with this equation:V = (3.14159)(D)(N)/1000To cut a 150-mm-diameter workpiece at a cutting speed of 200 m/min, thespindle speed to provide the required cutting speed is calculated to beapproximately 1325 rpm using the above equation...

  • Page 401

    SpindlesChapter 1717-3The S-word units represent revolutions per minute (RPM) in most cases.Only during CSS programming are the S-word units different. While CSSmode is active, the S-word units represent surface feet per minute. Onlythe controlling spindle can change its S-word mode from RPM to C...

  • Page 402

    SpindlesChapter 1717-4Each P-word corresponds to a specific axis assigned to it in AMP. AnyCSS axis changes made by programming a P-word in the G96 blockremain in effect regardless of what mode the control is in. The defaultCSS axis is assigned to P0 and is active on power-up and after a controlr...

  • Page 403

    SpindlesChapter 1717-5Figure 17.2Constant Surface Speed Mode (G96)ChuckÆ 200Æ 1003.2.1.CAUTION: During the blocks when CSS mode (G96) isactive, the programmed S-word units are surface speed perminute. For systems allowing multiple spindles, when CSS isactive, the S-word units for all spindles i...

  • Page 404

    SpindlesChapter 1717-6Important: If it is desirable to prevent the spindle speed from reaching amaximum RPM a ceiling can be placed on the spindle speed at a ratebelow the maximum AMP setting. For details, see the CSS notes on page17-6.Relationships between spindle speeds and cutting diameters ar...

  • Page 405

    SpindlesChapter 1717-7In G96 mode, spindle speeds increase as the workpiece diameterdecreases. When the spindle speed reaches the upper limit, it is held atthis value even if the theoretical spindle speed exceeds that value. Thismaximum RPM may also be affected by the maximum gear speed setfor a ...

  • Page 406

    SpindlesChapter 1717-8When programming M58, the M59 code is cancelled and the G96 modebecomes active again. The spindle maintains the same surface speedthat was in effect prior to the execution of M59 unless an S-code wasspecified in the M59 block.CAUTION: Restoring the constant surface speed mod...

  • Page 407

    SpindlesChapter 1717-9In the G97 mode, the spindle revolves at the programmed RPM regardlessof the position of the cutting tool.For example, to revolve the spindle at 500 rpm, program:G97 S500 M03;The G97 code is modal and remains active until it is cancelled by the G96code.Important: If an S-wor...

  • Page 408

    SpindlesChapter 1717-10For systems with no spindle configured, simulated spindle feedback isprovided for the primary spindle. This allows all control features thatrequire spindle feedback, i.e., IPR feedrate, threading, CSS, to simulate thefeedback from a spindle even through the AMPed system con...

  • Page 409

    SpindlesChapter 1717-11Important: A spindle orient is also sometimes automatically requested bythe control when performing some of the drilling cycles described inchapter 26. This drilling cycle orient orients to either the AMP-definedposition if using a closed-loop orient type or to the position...

  • Page 410

    SpindlesChapter 1717-12To cancel spindle orient:Program:Meaning:Spindle 1code M19M03M04M05Spindle 1 clockwiseSpindle 1 counterclockwiseSpindle 1 stopSpindle 2code M19.2M03.2M04.2M05.2Spindle 2 clockwiseSpindle 2 counterclockwiseSpindle 2 stopSpindle 3code M19.3M03.3M04.3M05.3Spindle 3 clockwiseSp...

  • Page 411

    SpindlesChapter 1717-13Example 17.19/290 Control with 3 Spindles Configured in AMPN0001 M05Spindle 1 stopN0002 M05.2 M05.3Spindles 2 & 3 stopN0003 M03 M04.2 S150Spindle 1 clockwise 150 rpmSpindle 2 counterclockwise 150 rpmN0004 M03.2 M03.3 S10Spindle 2 clockwise 10 rpmSpindle 3 counterclockwi...

  • Page 412

    SpindlesChapter 1717-14To function as a virtual C axis, the lathe spindle must have a precisionencoder that provides position data to the control. There can be only oneencoder marker per revolution of the spindle. When the virtual C axisfeature is activated, the control switches spindle operation...

  • Page 413

    SpindlesChapter 1717-15Only the primary spindle (selected with G12.1) can be used in coordinationwith virtual C. On systems allowing auxiliary spindles, if the auxiliaryspindle is the controlling spindle when virtual C is activated, this errormessage appears, “ILLEGAL CODE DURING VIRTUAL C.”C...

  • Page 414

    SpindlesChapter 1717-16Where:Is:Rthe radius at which the feed axis (typically the X axis) is positioned at the start ofcylindrical interpolation. Can be used to alter the feed axis depth if programmed in aG16.1 block during cylindrical interpolation.Cthe angular coordinate (if in G90 absolute mod...

  • Page 415

    SpindlesChapter 1717-17If G02 or G03 circular interpolation is made active while in G16.1cylindrical interpolation mode, a circular cut can be made around thecircumference of the part (such as the shape cut in Figure 17.3). This isaccomplished by programming the C and Z axis endpoints along with ...

  • Page 416

    SpindlesChapter 1717-18mode. If the AMP parameter Automatic Home on Virtual C Entry isset to “NO” (refer to the documentation provided by your system installer),you need to home the virtual C axis, typically by programming a M19S0.The control positions the tool on the cylindrical work surface...

  • Page 417

    SpindlesChapter 1717-19Where :Is :qThe angle to be programmed for the virtual C axis.LThe length of the arc along the circumference of the cylinder, as required todefine a legal endpoint for the arc programmed in the G02/G03 block.RThe radius at which the feed axis is positioned. This is the acti...

  • Page 418

    SpindlesChapter 1717-20End face milling coordinates the motion of the virtual C axis with that ofthe linear machine axes to machine contours on the end face of aworkpiece as shown in Figure 17.5. Virtual C axis end face milling isturned on using a G16.2 block and turned off with a G15 block (or a...

  • Page 419

    SpindlesChapter 1717-21End Face Milling Block FormatThe block used to activate virtual C axis end face milling has this format:G16.2 X__ Y__ Z__ R__ F__Where :Is :XThe coordinate (if in G90 absolute mode) or the linear distance (if in G91incremental mode) to which the X axis is to move. Be aware ...

  • Page 420

    SpindlesChapter 1717-22When end face milling is activated, the circle plane is set to XY. The Xaxis becomes the primary axis of the circle plane and remains so, as longas the G16.2 mode is active. If the active plane is changed, the changedoes not become effective until the G16.2 mode is cancelle...

  • Page 421

    SpindlesChapter 1717-23Use this feature to synchronize the position and/or velocity between twospindles with feedback using your 9/440, 9/260, or 9/290 control.Two types of synchronization are available:Velocity — synchronizes only the speed between two spindlesVelocity and Position — synchro...

  • Page 422

    SpindlesChapter 1717-24Use these three G--codes to manipulate the spindle synchronization feature:Set spindle positional synchronization (G46)— sets the follower spindlespeed/direction and relative position offset to match the controllingspindle.Set active spindle speed synchronization (G46.1)...

  • Page 423

    SpindlesChapter 1717-25The following example assumes that the controlling and follower spindleswere defined as spindle 2 and spindle 1, respectively, by your systeminstaller.Example 17.4Spindle SynchronizationM03 S200;Spindle 1 clockwise 200 rpmM04.2 S400;Spindle 2 counterclockwise at 400 rpmG12....

  • Page 424

    SpindlesChapter 1717-26Activate Spindle Speed Synchronization (G46.1)Use the “Activate Spindle Speed Synchronization” to synchronize speedand direction only. Using G46.1 does not guarantee a consistent positionaloffset between the two spindles. During a G46.1, the follower spindleattempts to ...

  • Page 425

    SpindlesChapter 1717-27When using the synchronized spindle feature, remember:you cannot retrace through a synchronization block (G45, G46, orG46.1). However, you can retrace through blocks wheresynchronization was already active.in dual--process systems, both spindles used for synchronizationmust...

  • Page 426

    SpindlesChapter 1717-28When synchronization is active, any part program commandsdestined for the follower spindle (i.e., M03, M03.2,M03.3...G12.1, G12.2, and G12.3) will cause an error. On amultiprocess configuration, this is true of either process.On a multiprocess 9/Series, the process controll...

  • Page 427

    Chapter1818-1Programming FeedratesThis chapter describes 9/Series control feedrates, including special AMPassigned feedrates and automatic acceleration/deceleration.For information about:See page:Feedrates18-1Special AMP-assigned Feedrates18-8Automatic Acceleration/Deceleration18-10Feedrates are ...

  • Page 428

    Programming FeedratesChapter 1818-2Figure 18.1Programming a Tangential FeedrateZZXXLinear interpolationCircular interpolationprogrammedfeedrateX axisfeedratestartpointZ axisfeedrateendpointprogrammedfeedrateend pointX axisfeedratestartpointZ axisfeedrateFor example, if a feedrate is programmed as...

  • Page 429

    Programming FeedratesChapter 1818-3For outside arc paths, the speed of the tool tip relative to the part surfacecan be determined using the following formula:RpTool tip speed=Fx----RcWhere :Is :Fprogrammed feedrateRcradius of the arc measured to the center of the tool radiusRpprogrammed radius of...

  • Page 430

    Programming FeedratesChapter 1818-4In the G94 mode (feed per minute), the numeric value following address Frepresents the distance the axis or axes move (in inches or millimeters) perminute. If the axis is a rotary axis, the F-word value represents the numberof degrees the axis rotates per minute...

  • Page 431

    Programming FeedratesChapter 1818-5Since the G95 code is modal any F-word designated in any block after theG95 is considered a feed distance per spindle revolution until a G94 isexecuted.Figure 18.4Feed Per Revolution Mode (G95)ChuckWorkpieceCutting toolF“F”is the distance the tool moves perr...

  • Page 432

    Programming FeedratesChapter 1818-6Rapid feedrate drives all active axes at a speed which creates a linearmove. The control determines which axis must travel the furthest anddrives that axis at its maximum feedrate assigned in AMP. Use rapidfeedrate to position the tool to a specified point at a ...

  • Page 433

    Programming FeedratesChapter 1818-7<RAPID FEEDRATE OVERRIDE>Use <RAPID FEEDRATE OVERRIDE>on the MTB panel to override therapid feedrate for G00 mode in four increments:F1 ---- percent value set in AMP by your system installer25%50%100%.Important: Normally this override is not active f...

  • Page 434

    Programming FeedratesChapter 1818-8The maximum allowable speed for each axis is set in AMP. If any axisfeedrate exceeds the maximum allowable speed for that axis the controlautomatically adjusts the feedrate to a value that does not cause axis speedto exceed its set limit.Figure 18.5Feedrate Clam...

  • Page 435

    Programming FeedratesChapter 1818-9Important: Single-digit feedrates are always entered as per minutefeedrates (IPM or MMPM) regardless of the control’s current feedratemode. When a single-digit feedrate is programmed, the controlautomatically switches to the IPM or MMPM mode. The controlautoma...

  • Page 436

    Programming FeedratesChapter 1818-10If you use this feature simultaneously with the Dry Run feature, thefeedrates that are assigned to the External deceleration feature are used.The feedrates for this feature are not related to the Dry Run feedrates,although the operation of this feature is simil...

  • Page 437

    Programming FeedratesChapter 1818-11Refer to the table below to determine the type of acceleration/decelerationperformed for manual motion and programmed moves.Table 18.BAcc/Dec Type Performed with Manual Motion and Programmed MovesMotion TypeAlways Uses ExponentialAcc/DecConfigurable in AMP bySy...

  • Page 438

    Programming FeedratesChapter 1818-12To begin and complete a smooth axis motion, the 9/Series control uses anexponential function curve to automatically accelerate/decelerate an axis.Your system installer sets the acceleration/deceleration time constant “T”for each axis in AMP. Figure 18.6 sho...

  • Page 439

    Programming FeedratesChapter 1818-13Axis motion response lag can be minimized by using Linear Acc/Dec forthe commanded feedrates. The system installer sets Linear Acc/Dec valuesfor interpolation for each axis in AMP. Figure 18.7 shows axis motionusing Linear Acc/Dec.Figure 18.7Linear Acc/DecTimeT...

  • Page 440

    Programming FeedratesChapter 1818-14When S--Curve Acc/Dec is enabled, the control changes the velocityprofile to have an S--Curve shape during acceleration and decelerationwhen in Positioning or Exact Stop mode. This feature reduces themachine’s axis shock and vibration for the commanded feedra...

  • Page 441

    Programming FeedratesChapter 1818-15Programmable Acc/Dec allows you to change the Linear Acc/Dec modesand values within an active part program via G47.x and G48.x codes.You cannot retrace through programmable acc/dec blocks (G47.x andG48.x). However, you can retrace through blocks where programma...

  • Page 442

    Programming FeedratesChapter 1818-16Selecting Linear Acc/Dec Values (G48.n - - nonmodal)Programming a G48.x in your part program allows you to switch LinearAcc/Dec values in nonmotion blocks. Axis values in G48.n blocks willalways be treated as absolute, even if the control is in incremental mode...

  • Page 443

    Programming FeedratesChapter 1818-17When Acc/Dec is active, the control automatically performs Acc/Dec togive a smooth acceleration/deceleration for cutting tool motion.However, there are cases in which Acc/Dec can result in rounded cornerson a part during cutting. In Figure 18.9, this problem is...

  • Page 444

    Programming FeedratesChapter 1818-18Exact Stop Mode (G61 - - modal)G61 establishes the exact stop mode. The axes move to the commandedposition, decelerate and come to a complete stop before the next motionblock is executed. To cancel this mode, program G62, or G63.Cutting Mode (G64 - - modal)G64 ...

  • Page 445

    Programming FeedratesChapter 1818-19When the corner angle, A, is larger than the value set for “min. angle forcorner override” in AMP, the programmed feedrate is overridden frompoint “a” to point “b,” and from point “b” to point “c.”The system installer sets these values in AM...

  • Page 446

    Programming FeedratesChapter 1818-20Figure 18.11Programmed Feedrate Not ReachedLinearAccelProgrammedfeedrateZ4.8Z4.9F100F60ZFEEDRATED I S T A N C EZ5.0Z5.1Feedrate clamped here to allowtime for decelerationLinearDeceleration12162-INormally this causes no problem. However, in cases where a series ...

  • Page 447

    Programming FeedratesChapter 1818-21To avoid this feedrate limitation, the short block Acc/Dec clamp can bedisabled by programming a G36.1. In this mode, the control assumes thatno rapid decelerations are required and allows axis velocities to go higherthan they otherwise would. Activate G36.1 mo...

  • Page 448

    Programming FeedratesChapter 1818-22G36 and G36.1 are modal. The control should only be in short blockcheck disable mode (G36.1) when executing a series of fast short blocksthat contain only slight changes in direction and velocity. What constitutesa slight change in direction and velocity depend...

  • Page 449

    Chapter1919-1Dual Axis OperationThe Dual Axes feature lets the part programmer simultaneously controlmultiple axes while programming commands for only one. It differs fromthe split axis feature of the 9/Series control in that the split axis feature isused to control a single axis positioned by tw...

  • Page 450

    Dual Axis OperationChapter 1919-2Figure 19.1Dual Axis ConfigurationAxis 1Lead screwServomotorAxis 2Lead screwServomotorEncoderDual Axes - two completelyseparate axes responding tothe same programmingcommands.EncoderThe 9/Series control can support two dual axis groups. A dual axis groupconsists o...

  • Page 451

    Dual Axis OperationChapter 1919-3Figure 19.2 shows the position display for a system that contains a dualaxis group containing two axes with a master axis name of X. Whether ornot all axes of a dual group show up on the position display is determinedin PAL by your system installer.Figure 19.2Axis...

  • Page 452

    Dual Axis OperationChapter 1919-4CAUTION: Be careful when an axis is unparked. Anyincremental positioning requests you make to the dual axisgroup are referenced from the current location of all axes in thedual group. This includes any manual jogging or anyincremental part program moves. When an a...

  • Page 453

    Dual Axis OperationChapter 1919-5Homing Axes SimultaneouslyThis method allows a request for all axes in the dual group to be homed atthe same time. This does not mean that all axes reach home at the sametime. Keep in mind that your system installer can define differentfeedrates and different home...

  • Page 454

    Dual Axis OperationChapter 1919-6Important: You can use the PAL axis mover feature if it is necessary toposition dual axis group members separately without requiring anyparking. Refer to the PAL manual and the system installer’sdocumentation for details.Invalid Operations on a Dual AxisTable 19...

  • Page 455

    Dual Axis OperationChapter 1919-7Give consideration to offsets used for a dual axis. In most cases, each axiscan have independent offset values assigned to it. This section describesthe difference in dual axis operation when it concerns offsets. How toactivate/deactivate and enter these offset va...

  • Page 456

    Dual Axis OperationChapter 1919-8Set ZeroYou can perform a set zero operation on the axes in a dual group on anindividual basis. For example, if you have a dual axis named X and itconsists of two axes, X1 and X2, when the set zero operation is executedthrough PAL, you must specify which axis in t...

  • Page 457

    Chapter2020-1Tool Control FunctionsThis chapter describes these tool control functions:Topic:On page:Programming a T-word20-3Entering tool offset data20-6Tool management20-14Programming a T-word ---- Different formats available for selecting atool number and tool offsetsTool length offsets ---- C...

  • Page 458

    Tool Control FunctionsChapter 2020-2Modern machining processes usually require a machine that is capable ofselecting different tools. Typically tools are mounted in a turret andassigned tool numbers as illustrated in Figure 20.1. The tool length offsetdata, tool tip radius data, tool wear compens...

  • Page 459

    Tool Control FunctionsChapter 2020-3Important: If tool life management is being used on the system, see thetool management section in this chapter for details on programming aT-word. This section assumes that the tool life management feature is notbeing used.Your system installer determines the f...

  • Page 460

    Tool Control FunctionsChapter 2020-4Example 20.2Using T-word Format #3T2013;This example first calls for tool number 2 to be rotated into position, then data is accessed fromthe offset tables (chapter 3) for values under tool geometry offset number 13, and tool wearoffset number 13.From these sim...

  • Page 461

    Tool Control FunctionsChapter 2020-5Your system installer has the option in AMP to determine exactly when thegeometry and wear offsets take effect and when the tool position changesto the new shifted location. This manual makes the assumption that thesystem is configured to immediately shift the ...

  • Page 462

    Tool Control FunctionsChapter 2020-6You can enter data in the tool offset tables by programming the correctG10 command. This section describes the use of the G10 commands forthe lathe tool offset table.Important: Only the value in the offset table value changes when a G10code modifies a tool offs...

  • Page 463

    Tool Control FunctionsChapter 2020-7Example 20.5Using G10 to Change The Tool Offset TableN00001 G90;N00002 G10 L10 P4 Z2.1 Q1;Offset number 4 has a new value of 2.1 for tool offset in the Zdirection and new orientation value of 1 in geometry table. Thecurrent value for any axis not specified and ...

  • Page 464

    Tool Control FunctionsChapter 2020-8Manually Entering Random Tool DataData can be entered into the random tool table either manually, asdescribed here, by programming, or by running a backup program of thetool data. These other methods are described later in this section.To manually enter the ran...

  • Page 465

    Tool Control FunctionsChapter 2020-9RAPLCEVALUECLEARVALUECUSTOM ACTIVE BACKUPPOCKET ASSIGNMENT TABLEPAGE 1 OF 2PKTTOOLPKTTOOLPKTTOOL001000200200300010040050003006XXXX0070007008XXXX009010011012013014015016017018XXXX0190006020XXXX021022023024025026027028029030031032033034035036037038039The columns ...

  • Page 466

    Tool Control FunctionsChapter 2020-10To enter a custom tool (a tool that requires more than one tool pocket)enter the tool number of the custom tool in the pocket that is to be usedas the “shaft pocket”. The shaft pocket is where the tool changer ispositioned when the particular custom tool i...

  • Page 467

    Tool Control FunctionsChapter 2020-11Format for Programming Random Tool TableUse this block to set data for the random tool pocket assignment table:G10.1 L20 P__ Q__ O__ R__;Where :Is :G10.1 L20This tells the control that the block will be setting data for the random tool pockettable. The G10.1 L...

  • Page 468

    Tool Control FunctionsChapter 2020-12Backup Random Tool TableThe control has a feature that allows you to back up (save) the informationin the random tool table. The control generates a G10.1 program from theinformation already in the table. To do this follow these steps:1.Press the {OFFSET} soft...

  • Page 469

    Tool Control FunctionsChapter 2020-13Starting a Program with a Tool Already ActiveYou can begin a part program with a tool already active in the chuck. Inorder for random tool to be able to properly handle that tool, it must enterinformation about that tool in the random tool table.Important: If ...

  • Page 470

    Tool Control FunctionsChapter 2020-14Use the automatic tool management feature to monitor the life of a tool,determine when the tool should be replaced, and provide a replacementtool when that tool is requested in a program.Tool are assigned to selected groups. Instead of calling a specific tool ...

  • Page 471

    Tool Control FunctionsChapter 2020-15Tool Life Measurement TypeThe control can measure the life of a tool using one of three possiblemethods:Tool Life TypeMethod SelectedMeaning0timeThis is selected by choosing 0 as the type of tool lifemeasurement.Time measures tool life as the length of time th...

  • Page 472

    Tool Control FunctionsChapter 2020-16Tool life Threshold PercentageA threshold level may also be assigned to a tool group. The threshold levelis assigned as a percentage of the total expected life of the tool. When atool reaches this threshold level, it is classified as old for that tool group.A ...

  • Page 473

    Tool Control FunctionsChapter 2020-17Figure 20.2Typical Tool Group Directory ScreenEDITGROUPDELETEGROUPDELETEALLENTRY GROUP NO:TOOL GROUP DIRECTORYPAGE 1 0F 1(FILE NAME)GROUPTOOL NUMBER1124488255639099At this point, you can delete any or all tool groups that already exist forsome reason follow th...

  • Page 474

    Tool Control FunctionsChapter 2020-18Figure 20.3Typical Tool Group Data ScreenCHANGETOOLINSERTTOOLDELETETOOLCHANGETYPECHANGET RATEENTER DATA:EDIT TOOL GROUP 1PAGE1 OF 1(FILE NAME)THRESHOLD RATE =80%ENTRYTOOL NUMBERLIFE TYPE = TIMENOOFF NO122436485.From this screen, you can:Operation:Description:C...

  • Page 475

    Tool Control FunctionsChapter 2020-19This section assumes that tools have already been assigned to their specificgroups. This section describes specific information that is to be enteredinto the tool life management tables for the individual tools. Thisinformation may also be entered into the too...

  • Page 476

    Tool Control FunctionsChapter 2020-20If tool life is measured by the number of uses (1 is selected as tool lifetype), then the units for the expected tool is the number of programs thatthe tool may be selected as an active tool in. The accumulated life of atool is increased by one if that tool is...

  • Page 477

    Tool Control FunctionsChapter 2020-212.Press the {TOOL MANAGE} softkey.(softkey level 2)WORKCO-ORDTOOLWEARTOOLGEOMETTOOLMANAGERANDOMTOOLCOORDROTATEBACKUPOFFSETSCALNG3.Press the {TOOL DATA} softkey. The control displays the prompt“EDIT GROUP:”.(softkey level3)TOOLDIRTOOLDATABACKUPDATA4.Key in ...

  • Page 478

    Tool Control FunctionsChapter 2020-225.From this screen it is possible to perform the following operations.The application of these operations was described in detail earlier inthis section.Operation:Description:Enter or alter the toollength offset numberTo enter or alter a value for the tool len...

  • Page 479

    Tool Control FunctionsChapter 2020-23Important: G10 blocks may not be programmed when TTRC is active.CAUTION: Any time that a G10L3; block is executed thecontrol automatically clears all information that is in themanagement tables for all tools and tool groups.Any time after the G10L3 command, pa...

  • Page 480

    Tool Control FunctionsChapter 2020-24The following program blocks assign tools to groups, length and cuttercompensation offset numbers, and expected tool life to specific tools. Thisinformation is assigned to the last group number programmed in a blockusing the P-word. The format for these blocks...

  • Page 481

    Tool Control FunctionsChapter 2020-25Example 20.6Programming Tool Life Management DataProgram BlockDescriptionG10L3;Starts loading tables.P1I1Q60;Begins loading data for tool group 1. Type 1 (number of uses)measurement. Threshold 60%.T1H5D7L25;Places tool 1 in group 1 with length offset number of...

  • Page 482

    Tool Control FunctionsChapter 2020-262.Press the {TOOL MANAGE} softkey.(softkey level 2)WORKCO-ORDTOOLWEARTOOLGEOMETTOOLMANAGERANDOMTOOLCOORDROTATEBACKUPOFFSETSCALNG3.Press the {BACKUP DATA} softkey. The prompt “BACKUPFILENAME:” is displayed on the input line.(softkey level 3)TOOLDIRTOOLDATAB...

  • Page 483

    Tool Control FunctionsChapter 2020-27Example 20.7Assume your system installer has set the following constraints in AMP:- the tool group boundary is set as 100- the T-word format is configured as 2-digit geometry and wear (seesection 20.1)- the maximum allowable T-word is configured as a 5-digit n...

  • Page 484

    Tool Control FunctionsChapter 2020-28Example 20.8Programming Tool Changes Using Tool Life Management.Example 20.8 assumes that:- your system installer has configured in AMP the boundary for toollife management at 100- the tool changer is located at the secondary machine home pointcalled by a G30;...

  • Page 485

    Chapter2121-1Tool Tip Radius Compensation (TTRC)FunctionThis chapter describes Tool Tip Radius Compensation function. Majortopics include:Topic:On page:Programming TTRC21-4Generation blocks21-8Tool paths (Type A)21-10Tool paths (Type B)21-20Tool path during TTRC21-30Special cases21-35Error detect...

  • Page 486

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-2Figure 21.1Taper and Arc Cutting Without TTRCWithout TTRC active,control assumes toolhas a perfect pointActual tooltip radiusCuttingtoolPartprofileMaterial left uncutdue to radius oftool tipPut the radius of the tool and tool orientation da...

  • Page 487

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-3outside ---- Refer to an angle between two intersecting programmed toolpaths outside if, in the direction of travel, the angle measured clockwisefrom the second tool path into the first is greater than 180°. SeeFigure 21.2. If one or both ...

  • Page 488

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-4This table highlights the differences between the two types:Type of MoveType AType BEntry Move IntoTTRC-- The tool takes the shortest possiblepath to its offset position.-- The tool stays at least one radius awayfrom the start-point of the ...

  • Page 489

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-5Figure 21.3TTRC DirectionG42; CompensationrightG41; CompensationleftG40; CompensationcancelProgrammed tool pathand directionImportant: The TTRC function is not available during any of the threadcutting cycles. TTRC must be canceled before a...

  • Page 490

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-6You can program TTRC in various ways. Example 21.1 shows 1-, 2-, and3-block programs activating TTRC with entry moves.Example 21.1Initializing TTRCAssume: G18 (ZX Plane Selection)Program BlockCommentOne BlockG42 T0016 X1 Z1;Sets compensatio...

  • Page 491

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-7Important: The TTRC feature is not available for any motion blocks thatare programmed in MDI mode. See page 21-30. The TTRC mode can bealtered by programming either G41, G42, or G40, or the tool radius can bechanged in an MDI program. Howev...

  • Page 492

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-8Figure 21.5Results of TTRC Program ExamplestartpointCutting tool center pathXZN1N2N3N4N5N6In certain instances, TTRC creates a non-programmed move called agenerated block. These blocks improve cycle time and corner-cuttingquality.TTRC gener...

  • Page 493

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-9The generated block between the two tool paths can be programmed aslinear or circular with these G-codes:G39(or G39.1);Where :Causes:G39linear transition blocks. If neither G39 or G39.1 is programmed, G39is the default. This command is moda...

  • Page 494

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-10The easiest way to demonstrate the cutting tool’s the actual tool paths whenusing TTRC type A is by pictorial representation. The followingsubsections describe the cutter path along with a figure to clarify thedescriptionAn entry move is...

  • Page 495

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-11Figure 21.8Tool Path for Entry Move Straight Line-to-Straight Line0 £q £9090 £q £180270 £q £360180 £q £270G41ProgrammedpathG42G41ProgrammedpathG42G41ProgrammedpathG42G41ProgrammedpathG42Start-pointStart-pointStart-pointStart-pointq...

  • Page 496

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-12If the next programmed move is circular (an arc), position the tool at rightangles to a tangent line drawn from the start-point of that circular move.Figure 21.9Tool Path for Entry Move Straight Line-to-Arc0 £q £9090 £q £180180 £q £2...

  • Page 497

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-13Example 21.3Sample Entry Move After Non-Motion BlocksAssume current compensation plane is the ZX plane.N01X0Z0;N2G41T1;This block commands compensation leftN3M02;This is not the entry block since no axis motion takes place inthe current pl...

  • Page 498

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-14Figure 21.10Results of Example 21.4G41Too many non-motionblocks hereTTRCreinitialized hereProgrammedpathrrrrrCancel the TTRC feature by programming G40. Refer to the path that istaken when the tool leaves TTRC as the exit move. The path th...

  • Page 499

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-15Example 21.5 gives some sample exit move program blocks.Example 21.5Type A Sample Exit MovesAssume the current plane is the XZ plane and TTRC is already activebefore the execution of block N100 in these program segments.N100X1.Z1.;N110X3.Z...

  • Page 500

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-16Figure 21.11 through Figure 21.15 show examples of typical exit movesusing type A TTRC. All examples assume that the number of non-motionblocks before the designation of the G40 command have not exceeded thenumber allowed as determined by ...

  • Page 501

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-17If the last programmed move is circular (an arc), positioning the tool atright angles to a tangent line drawn from the end-point of that circularmove.Figure 21.12Tool Path for Exit Move Arc-to-Straight LineStart-pointStart-pointStart-point...

  • Page 502

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-18The I- and K-words in the exit move block define a vector that is used bythe control to redefine the end-point of the previously compensated move.I- and K-words are always programmed as incremental values regardless ofthe current mode (G90...

  • Page 503

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-19Figure 21.14Results of Example 21.6Compensated path using I, K vectorCompensated path if no I, K in G40 blockIntercept lineI, KProgrammed pathCompensated pathN10N11rrrIf the vector defined by I and/or K is parallel to the programmed tool p...

  • Page 504

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-20We demonstrate the actual tool paths taken by the cutting tool when usingTTRC type B by pictorial representation. The following subsectionsdescribe the cutter path along with a figure to clarify the description.An entry move is defined as ...

  • Page 505

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-21Figure 21.17 and Figure 21.18 show examples of typical entry moves usingtype B TTRC.Figure 21.17Tool Path for Entry Move Straight Line-to-Straight Line0 £q £9090 £q £180180 £q £270270 £q £360EG41G42ProgrammedpathG41G42Programmedpat...

  • Page 506

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-22If the next programmed move is circular (an arc), position the tool at rightangles to a tangent line drawn from the start-point of that circular move.Figure 21.18Tool Path for Entry Move Straight Line-to-Arc0 £q £9090 £q £180Programmed...

  • Page 507

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-23There is no limit to the number of blocks that can follow the programmingof G41 or G42 before an entry move takes place. The entry move isalways the same regardless of the number of blocks that do not programmotion in the current plane for...

  • Page 508

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-24Figure 21.19Too Many Non-Motion BlocksProgrammedpathG41rrToo many non motionblocks hereTTRCreinitialized hererrrProgram a G40 to cancel the TTRC feature. Refer to the path that is takenwhen the tool leaves TTRC is referred to as the exit m...

  • Page 509

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-25Example 21.9 gives some sample exit move program blocks.Example 21.9Sample Exit Move SegmentsAssume the current plane to be the ZX plane.N100X1Z1;N110X3Z3G40;Exit move.N100X1Z1;N110G40;N120X3Z3;Exit move.N100X1Z1;N110G40;N120...;No axis mo...

  • Page 510

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-26Figure 21.20 and Figure 21.21 show examples of typical exit moves usingtype B TTRC. All examples assume that the number of non-motion blocksbefore the designation of the G40 command has not exceeded the numberallowed as determined by your ...

  • Page 511

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-27If the last programmed move is circular (an arc), the tool is positioned atright angles to a tangent line drawn from the end-point of that circularmove.Figure 21.21Tool Path for Exit Move Arc-to-Straight LineqqqqEnd-pointEnd-pointEnd-point...

  • Page 512

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-28Figure 21.20 and Figure 21.21 assume that the number of blocks that donot contain axes motion in the currently selected plane, following G40before the exit move takes place, do not exceed an amount selected inAMP by your system installer. ...

  • Page 513

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-29Example 21.10Exit Move Defined By An I, K Vector But Limited To Tool RadiusAssume T1 radius is 3.N10 Z10.G41T1;N11 X10.Z2.I3K-10.G40;Figure 21.23Results of Example 21.10Intercept lineCompensated path using I, K vectorCompensated path if no...

  • Page 514

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-30Except for entry and exit moves, the basic tool path generated duringTTRC is the same for types A and B TTRC. Whether tool left or tool rightis specified, the path taken is a function of the angle between tool paths(G41 or G42) and the rad...

  • Page 515

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-31Figure 21.25 through Figure 21.28 illustrate the basic motion of the cuttingtool as it executes program blocks during TTRC.Figure 21.25TTRC Tool Paths Straight Line-to-Straight Line180 £q £270270 £q £36090 £q £1800 £q £90generated ...

  • Page 516

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-32Figure 21.26TTRC Tool Paths Straight Line-to-Arc0 £q £90generatedblocksProgrammedpathG41G42270 £q £360qrrr0 £q £90ProgrammedpathG41G42qr270 £q £360ProgrammedpathG42G41rG39.1 (Circular Generated Block)G39 (Linear Generated Block)rG3...

  • Page 517

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-33Figure 21.27TTRC Tool Paths Arc-to-Straight Line0 £q £90ProgrammedpathqLineargeneratedblocksrrrG41G420 £q £90ProgrammedpathqrG41G42G39.1 (Circular Generated Block)G39 (Linear Generated Blocks)G39.1 (Circular Generated Block)rrProgramme...

  • Page 518

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-34Figure 21.28TTRC Tool Paths Arc-to-Arc90 £q £180180 £q £270270 £q £360ProgrammedpathProgrammedpathG41G41G42G42G42Programmedpathqqqrr270 £q £360G42Programmedpathqr0 £q £90G41G42ProgrammedpathqrrrrrG39.1 (Circular Generated Block)G...

  • Page 519

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-35The following subsections describe possible tool paths that can begenerated when programming one of the following during TTRC:changing TTRC direction (cross-over tool paths)exceeding the allowable number of consecutive, non-motion blocksdu...

  • Page 520

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-36The control generates the motion block that connects point 1 to point 2 asshown in these examples:Example 21.11Linear-to-Linear Change in TTRC Direction (Reversing Tool Path)N10 Z10.G41;N11 Z20.;N12 Z10.G42;N13 Z0.;Figure 21.29Results of E...

  • Page 521

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-37Example 21.13Linear-to-Linear Change in TTRC Direction(With Generated Blocks)N10 X15.Z10.G41;N11 X-5.Z8.;N12 X0.Z35.G42;Figure 21.31Results of Example 21.13CompensatedpathProgrammedpathPoint 2Point 1G42N12N11N10G41rrrrrrExample 21.14Linear...

  • Page 522

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-38Figure 21.32Results of Example 21.14Point 2Point 1N21 (G42)CompensatedpathProgrammedpathN20 (G41)For one of these cases that changes the TTRC direction, the controlattempts to find an intersection of the actual compensated tool paths:Linea...

  • Page 523

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-39Figure 21.34Change in Compensation With No Possible Tool Path IntersectionsCompensated pathProgrammed path G41G42G42Programmed path G42Compensated pathCompensated pathProgrammed path G41r1r2r1r1r1r2rrG41The control always looks ahead to th...

  • Page 524

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-40When scanning ahead, if the control does not find a motion block beforethe number of non-motion blocks has been exceeded, it does not generatethe normal TTRC move. Instead the control sets up the compensationmove with an end-point one-tool...

  • Page 525

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-41Figure 21.36Too Many Non-Motion Blocks Following a Circular MoveToo manynon-motionblocks hereToo manynon-motionblocks hereToo many non-motionblocks here++++rrrrrProgrammedpath G42CompensatedpathProgrammedpath G42CompensatedpathProgrammedpa...

  • Page 526

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-42Figure 21.37Compensation Corner Movement for Two Generated BlocksThis block is eliminated if bothhX1-X2h andhZ1-Z2h areless than AMP parameterX2Z2New block if blockis eliminatedX1Z1CompensatedProgrammedWhen the control generates 3 motion b...

  • Page 527

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-43If a tool becomes excessively worn, broken, or for any other reasonrequires the changing of the programmed tool tip radius, TTRC should becancelled and re-initialized after the tool has been changed. See pageNO TAG on changing the tool off...

  • Page 528

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-44Figure 21.39Linear-to-Linear Change in Cutter Radius During CompensationNo control generatedmotion blocksWith control generatedmotion blocksCompensatedpathProgrammedpathN10N11N12CompensatedpathProgrammedpathGeneratedblocksN10N11N12N10N11 D...

  • Page 529

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-45Figure 21.41 describes the tool path when the programmed moves arecircular-to-circular.Figure 21.41Circular to Circular Change in Cutter Radius During CompensationNo control-generatedmotion blocksWith control-generatedmotion blocksProgramm...

  • Page 530

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-46The new offset is activated. TTRC is able to compensate for this newdiameter by modifying the saved jogged path. This path is modified sothat the new tool cuts the same part as the old tool. The absolute positionof the machine will, theref...

  • Page 531

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-47Figure 21.42 shows an example of a typical change in tool radius duringjog retract with TTRC active:Figure 21.42Change in Cutter Radius During a Jog RetractOriginal toolradiusNew toolradiusDifference intool radius DRProgrammed pathCompensa...

  • Page 532

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-48Figure 21.43TTRC Interrupted with MDI Blocks3 MDI blocks(no compensationapplied)End-pointof MDIrrCompensationreinitializes hereG42Programmed pathImportant: If during cutter compensation, you switch out of automaticmode and either:generate ...

  • Page 533

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-49Figure 21.44Cutter Compensation Re-Initialized after a Manual or MDI Operation.Manually jog axes (or any MDIexecution) and return to thecompensated path.Cutter Compensation is re-initialized here. The control assumes that thecurrent positi...

  • Page 534

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-50specified, the control executes the move prior to the return to homeoperation as an exit move. This can cause undesired overcutting of thepart.If compensation was not cancelled using a G40 command before returningto machine or secondary ho...

  • Page 535

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-51We recommend that you cancel TTRC by using a G40 command beforeany modifications to the current work coordinate system are made,including any offsets or any change of the coordinate system (G54-G59.3).If compensation is not cancelled using...

  • Page 536

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-52During normal program execution, the control is constantly scanning aheadseveral blocks to set up the necessary motions to correctly execute thecurrent block. This is called Block Look-Ahead.The 9/Series control has 21 set-up buffers. Diff...

  • Page 537

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-53Backwards Motion DetectionThe compensated tool path is parallel to but in the opposite direction of theprogrammed tool path.Figure 21.47Typical Backwards Motion ErrorProgrammedPathACompensatedPathCompensated pathmotion opposite ofprogramme...

  • Page 538

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-54InterferenceThis error occurs when compensation vectors intersect. Normally whenthis intersection occurs, a backwards motion error is generated; however, afew special cases exist that are caught only by interference error detection.Figure ...

  • Page 539

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-55Error detection M-codes are only functional when TTRC is active. TTRCis active when the control is in G41 or G42 mode and has already madethe entry move into compensation. If an M800 or M801 is programmedin G40 mode or before the entry mov...

  • Page 540

    Tool Tip Radius Compensation (TTRC)FunctionChapter 2121-56

  • Page 541

    Chapter2222-1Single-Pass Turning CyclesSingle-pass turning cycles consist of these cycles:G20 Single-pass O.D. and I.D. roughing cycleG24 Single-pass rough facing cycleG21 Simple threading cycleThis chapter describes the following major topics:Topic:On page:G2022-1G2422-8These cycles are called s...

  • Page 542

    Single-Pass Turning CyclesChapter 2222-2Important: Descriptions in this chapter are written assuming the control isin the G18 plane and that plane has been defined as the ZX plane. If yoursystem has a different plane active, operation of these features is different.Parameters are defined here ass...

  • Page 543

    Single-Pass Turning CyclesChapter 2222-3CAUTION: When programming the single-pass cycle, the firstmove to the depth of cut is a rapid move. Make sure that thetool does not contact the part on this initial move.The feedrate used in the single-pass cycle is the currently activeprogrammed cutting fe...

  • Page 544

    Single-Pass Turning CyclesChapter 2222-4Example 22.1Straight Cutting CycleG90G00X40.Z60.;G20X28.Z25.F10.X24.;X20.;G00;Figure 22.2Results of Example 22.1X2535Cutting feedRapid feedZ202428

  • Page 545

    Single-Pass Turning CyclesChapter 2222-5G20 Taper O.D. and I.D. RoughingA G20 block that includes an I-word generates a turning pass that producesa taper.Figure 22.3G20 Taper Cutting CycleCutting feedRapid feedIZXThe format for the G20 single-pass cycle to cut a taper is:G20X__Z__I__;Where :Is :X...

  • Page 546

    Single-Pass Turning CyclesChapter 2222-6After the G20 block is executed, the control re-executes the cycle for anyfollowing block that commands axis motion (until the cycle is cancelled).The value of the axis word in that block is used to replace the parameterdetermined with that axis word in the...

  • Page 547

    Single-Pass Turning CyclesChapter 2222-7Example 22.2Taper CuttingG90G00X50.Z106.;G20X38.Z46.I-11.F.5;X32.;X26.;X20.;Figure 22.5Results of Example 22.2Cutting feedRapid feed11604638322620ZX

  • Page 548

    Single-Pass Turning CyclesChapter 2222-8G24 calls either a straight or a tapered facing cycle. This cycle is asingle-pass cycle (makes only one cutting pass over the workpiece eachtime it is called).Use the G24 cycle to cut along the face of a workpiece (in this manual thatmeans it cuts along the...

  • Page 549

    Single-Pass Turning CyclesChapter 2222-9The feedrate used in the single-pass cycle is the currently activeprogrammed cutting feedrate. If desired, a different cutting feedrate maybe specified in the single-pass cycle block.The rapid feedrate (for the axis in motion as assigned in AMP) is used for...

  • Page 550

    Single-Pass Turning CyclesChapter 2222-10Example 22.3Straight Facing CycleG90G00X30.Z22.;G24X10.Z15.F10.Z13.;Z11.;G00;Figure 22.7Results of Example 22.3Cutting feedRapid feed151311XZ10

  • Page 551

    Single-Pass Turning CyclesChapter 2222-11G24 Tapered FacingA G24 block that includes a K-word generates a facing pass that producesa taper.Figure 22.8G24 Face Taper Cutting CycleXKZCutting feedRapid feedThe format for the G24 single-pass cycle to cut a taper on a face is:G24X__Z__K__;Where :Is :X...

  • Page 552

    Single-Pass Turning CyclesChapter 2222-12After the G24 block is executed the control re-executes the cycle for anyfollowing block that commands axis motion (until the cycle is cancelled).The value of the axis word in that block is used to replace the parameterdetermined with that axis word in the...

  • Page 553

    Single-Pass Turning CyclesChapter 2222-13After this G24 block is executed, the control re-executes the cycle for anyfollowing block that contains an axis word (until the cycle is cancelled).The value of this axis word is used to replace the parameter determinedwith that axis word in the original ...

  • Page 554

    Single-Pass Turning CyclesChapter 2222-14

  • Page 555

    Chapter2323-1Grooving/Cutoff CyclesThese two cycles are provided to perform grooving or cutoff operations:G76 Face Grooving CycleG77 O.D. & I.D. Grooving CycleThis chapter reviews the following major topics:Topic:On page:Face grooving cycle23-3O.D. & I.D. cycle23-6Important: Descriptions ...

  • Page 556

    Grooving/Cutoff CyclesChapter 2323-2Figure 23.1Tool Path during a G76 Face Grooving CycleTool path, cutting feedrateTool path, rapid feedrateNo motion, for drawing clarificationZDDDZZKKKXZXK+eK+eK+eK+eK+eK+eK+eK+eK+eeeeeeeeeeeeeI

  • Page 557

    Grooving/Cutoff CyclesChapter 2323-3Figure 23.2Tool Path during a G77 O.D. Grooving CycleZTool path, cutting feedrateTool path, rapid feedrateNo motion, for drawing clarificationXZXKXXI+eI+eI+eI+eI+eI+eI+eI+eI+eIIIDDDeeeeeeeeeeeeeThese cycles may also be used as cut off cycles. The tool infeeds i...

  • Page 558

    Grooving/Cutoff CyclesChapter 2323-4The format for this cycle is:G76X__Z__I__K__F__D__;Where :Is :X__the location where the last groove is cut. If only one groove is to be cut do notprogram X. This may be programmed as either an incremental or absolute value.Remember that its value is also affect...

  • Page 559

    Grooving/Cutoff CyclesChapter 2323-5Figure 23.3G76 Face Grooving Cycle ParametersXZZ inc.KeX inc.Z abs.X abs.IThe retraction amount e is set in AMP by the system installer.Example 23.1G76 Grooving CycleAbsolute ProgrammingIncremental ProgrammingG00X7.6Z5.3;G00X-1.8Z-1.2G76X2.0Z3.6I-2.8K-0.8D0;G76...

  • Page 560

    Grooving/Cutoff CyclesChapter 2323-6Figure 23.4Results of G76 Grooving Cycle ExampleZ6.55.33.6I=-2.8K=-0.8e2.04.87.69.4XThe G77 O.D. & I.D. grooving cycle is typically used to cut multiplegrooves in a workpiece or as a cut off cycle. When the cycle is performedthe groove or cutoff is cut by i...

  • Page 561

    Grooving/Cutoff CyclesChapter 2323-7The format for this cycle is:G77X__Z__I__K__F__D__;Where :Is :Z__the location where the last groove is cut. If only one groove is to be cut do notprogram Z. This may be programmed as either an incremental or absolute value.X__the total depth of the groove from ...

  • Page 562

    Grooving/Cutoff CyclesChapter 2323-8Figure 23.5G77 O.D. & I.D. Grooving Cycle ParametersXIeKZ abs.Z inc.ZX inc.X abs.Example 23.2G77 O.D. & I.D. Grooving Cycle Used As a Cutoff CycleAbsolute ProgrammingIncremental ProgrammingG00G90X42.Z56.;G00G91X-36.Z-9.;G77X19.Z21.I-8.K-14.D2.;G77X-23.Z...

  • Page 563

    Grooving/Cutoff CyclesChapter 2323-9Figure 23.6Results of G77 Used as a Cutoff Cycle ExampleK distance ignored forlast groove (too closeto previous groove)I=-8eZX78423419142128425665K=-14D=2END OF CHAPTER

  • Page 564

    Grooving/Cutoff CyclesChapter 2323-10

  • Page 565

    Chapter2424-1Compound Turning RoutinesCompound turning routines are routines that make multiple passes acrossthe workpiece to cut a specific contour into the workpiece. A set ofblocks, called contour blocks, define the final contour shape of theworkpiece. A calling block, containing one of the fo...

  • Page 566

    Compounding Turning RoutinesChapter 2424-2The G73 contour turning routine is used to rough out the contour of aworkpiece by making repetitive cuts parallel to the Z axis. A final passmay be made with this routine to cut parallel to the final contour of theworkpiece. A finish allowance may be left...

  • Page 567

    Compound Turning RoutinesChapter 2424-3Case 1:A Case 1 G73 roughing routine is defined when the workpiece contour hasno pockets. The following constraints must be met in order to successfullyperform a Case 1 contouring routine:The first block of the contour program must command motion in onlythe ...

  • Page 568

    Compounding Turning RoutinesChapter 2424-4Figure 24.2Workpiece Finish Contour Case 1 and Case 2 (G73)XStart PointZXStart PointZCase 1Case 2The G73 block is programmed with this format:G73P__Q__U__W__I__K__D__R__F__S__T__;Where :Is :P__the sequence number (N-word) of the first block in the set of ...

  • Page 569

    Compound Turning RoutinesChapter 2424-5Where :Is :I Kdetermine the amount of stock to be removed on the final pass of the routine. Theactual amount of material removed on this final pass is equal to the average of the Iand K parameters ((I+K)/2). It is not necessary to enter both of these paramet...

  • Page 570

    Compounding Turning RoutinesChapter 2424-6Figure 24.3Parameters for G73 Roughing RoutineShape after roughingShape after roughingand final passWorkpiece finishedshapeStart PointD(U+W)/2ZXR(I+K)/2In Figure 24.3, the contour blocks for this routine must define all motionsthat would cut the workpiece...

  • Page 571

    Compound Turning RoutinesChapter 2424-7The G73 roughing routine activates the Tool Tip Radius Compensation(TTRC) function regardless of whether it was active prior to the roughingroutine. If TTRC was not active, the roughing routine uses the tool tipradius data of the previously programmed T-word...

  • Page 572

    Compounding Turning RoutinesChapter 2424-8Figure 24.4Effect of Positive and Negative Finish Allowance ParametersZXBACACBU(-), W(-)U(-), W(+)U(+), W(+)U(+). W(-)BACCABThe workpiece contour in Figure 24.5 is illegal for the G73 roughingroutine and may not be cut. When this routine is used to cut a ...

  • Page 573

    Compound Turning RoutinesChapter 2424-9G73 Tool Paths, Case 1When the control executes a Case 1 G73 contouring path, these tool pathsare generated:Figure 24.6Tool Paths for Case 1 G73 Roughing RoutineCutting feedRapid feedXZRRRDDDShape defined by workpiececontour blocksFinal pass(Optional)(I+K)/2...

  • Page 574

    Compounding Turning RoutinesChapter 2424-10Figure 24.7Tool Retraction in Case 1 G73RRXZ45°45°4.Rapid traverse back along the X and Z axes to the coordinate that thelast rough cut started from in step 2.5.Move parallel to the X axis, at a feedrate F, a distance D asprogrammed in the G73 block.St...

  • Page 575

    Compound Turning RoutinesChapter 2424-11Example 24.2Case 1 G73 Roughing RoutineN011 G00X80.Z150.;N012 G73P14Q18U.8W.8I.6K.6D18.R7.F100;N013 M30;N014 X20.;N015 Z110.;N016 X40.Z80.;N017 Z50.;N018 X70.Z40.;Figure 24.8Results of Example 24.2Cutting feedRapid feedZXStart Point18 (D)1.40508011014040204...

  • Page 576

    Compounding Turning RoutinesChapter 2424-12Figure 24.9Tool Paths for Case 2 G73 Roughing Routine (with pockets)Start PointCutting feedRapid feedR(U+W+I+K)/2DImportant: Figure 24.9 does not show the optional final pass being made.This is for drawing clarity.In Figure 24.9, after the roughing passe...

  • Page 577

    Compound Turning RoutinesChapter 2424-13Figure 24.10Tool Motion in Case 2 G73Cutting feedRapid feedStart point18RD888674352In Figure 24.10, these tool paths are made:1.The tool is moved from the start point to first contour point atfeedrate F. This move must generate motion in both the X and Zaxe...

  • Page 578

    Compounding Turning RoutinesChapter 2424-147.A rough cut is made at feedrate F, into the workpiece parallel to the Xaxis to the X coordinate of the last rough cut.Steps 2 - 7 continue to repeat until the operation is aborted or the roughcontour shape is completed. The rough contour shape is compl...

  • Page 579

    Compound Turning RoutinesChapter 2424-15Figure 24.11Results of Example 24.3Cutting feedRapid feedXZStart Point10(I+K+U+W)/21.41008060402020406080100120140The G74 rough facing routine is used to rough out the contour of aworkpiece by making repetitive cuts parallel to the X axis. A final passmay b...

  • Page 580

    Compounding Turning RoutinesChapter 2424-16Figure 24.12Stock Removal in G74 Rough FacingShape after roughingand final passWorkpiece finishedshapeZFinishing allowanceStart pointTool paths determined automaticallyXThe G74 block has a P and Q parameter that call the sequence numbers(N-words) of the ...

  • Page 581

    Compound Turning RoutinesChapter 2424-17Case 2:A Case 2 G74 rough facing routine is defined when a workpiece contourcontains a pocket. The following constraints must be met in order tosuccessfully perform a Case 2 rough facing routine:The first block of the contour program must contain motion in ...

  • Page 582

    Compounding Turning RoutinesChapter 2424-18Where :Is :P__the sequence number (N-word) of the first block in the set of contour blocks thatdefine the final contour.Q__the sequence number (N-word) of the last block in the set of contour blocks thatdefine the final contour.U Wdetermine the finishing...

  • Page 583

    Compound Turning RoutinesChapter 2424-19Where :Is :R__used to program the retract amount made after each rough facing pass. Thisretract amount is an incremental, radius value measured parallel to the Z axis.Case 1 operations retract at a 45 degree angle to the Z axis and Case 2operations retract ...

  • Page 584

    Compounding Turning RoutinesChapter 2424-20In Figure 24.14, the contour blocks for this routine must define all motionsthat would cut the workpiece finished shape. The first block of the contourblocks must be the tool path from the start point to the point where theinitial roughing pass begins. T...

  • Page 585

    Compound Turning RoutinesChapter 2424-21Figure 24.15Effect of Positive and Negative Finish Allowance ParametersAABBXZCCCCAABBU(+), W(+)U(+), W(-)U(-), W(+)U(-), W(-)In Figure 24.16, the workpiece contour is illegal for the G74 roughingroutine and may not be cut. When this cycle is used to cut a c...

  • Page 586

    Compounding Turning RoutinesChapter 2424-22G74 Tool Paths, Case 1When the control executes a Case 1 G74 rough facing routine thefollowing tool paths are generated:Figure 24.17Tool Paths for Case 1 G74 Rough FacingXZ(U+W)/2Cutting feedRapid feedRRDDDDShape defined byworkpiece contourblocksFinal Pa...

  • Page 587

    Compound Turning RoutinesChapter 2424-23Figure 24.18Tool Retraction in Case 1 G74R45°45°RZX4. Rapid traverse back along the X and Z axes to the coordinate that thelast rough cut started from (in step 2).5. Move parallel to the Z axis, at a feedrate F, a distance D asprogrammed in the G74 block....

  • Page 588

    Compounding Turning RoutinesChapter 2424-24Example 24.5Case 1 G74 Rough Facing RoutineN011 G00X80.Z130.;N012 G74P14Q19U6.W6.I10.K10.D10.R8.F10.S60;N013 M30;N014 Z40.;N015 X60.;N016 X40.Z60.;N017 Z80.;N018 X30.Z90.;N019 Z110.;N020 X20.Z130.;Figure 24.19Results of Example 24.5Cutting feedRapid feed...

  • Page 589

    Compound Turning RoutinesChapter 2424-25G74 Tool Paths, Case 2If a pocket or multiple pockets are present in a workpiece face, it requires aCase 2 G74 rough facing routine.For Case 2, the control cuts each pocket separately, starting with the pocketclosest to the beginning of the operation. Figur...

  • Page 590

    Compounding Turning RoutinesChapter 2424-26Figure 24.21Tool Motion in Case 2 G74Cutting feedRapid feedStart pointR85D888216374In Figure 24.21, these tool paths are made:1. The tool is moved from the start point to the first contour point atfeedrate F. This move must generate motion in both the X ...

  • Page 591

    Compound Turning RoutinesChapter 2424-276. A rapid traverse is made back along the X and Z axes to the Xcoordinate that the last rough cut started from (in step 3) and a Zcoordinate that is D distance above the Z coordinate of the last roughcut.7. A rough cut is made at feedrate F, into the workp...

  • Page 592

    Compounding Turning RoutinesChapter 2424-28Figure 24.22Results of Example 24.6Cutting feedRapid feedStart pointZX10(I+K+U+W)/21.471201008060402012010080604020A

  • Page 593

    Compound Turning RoutinesChapter 2424-29In the G75 casting/forging roughing routine (also called pattern repeatingroutine), the control generates multiple cuts, each parallel to the workpiecefinal shape. Each cut is offset from the other an amount determined by theI, K and D parameters.Through th...

  • Page 594

    Compounding Turning RoutinesChapter 2424-30The G75 block is programmed with this format:G75 P__ Q__ I__ K__ U__ W__ D__ F__ S__ T__;Where :Is :P__The sequence number of the first block in the set of contour blocks that defines thefinished workpiece shape.Q__The sequence number of the last block i...

  • Page 595

    Compound Turning RoutinesChapter 2424-31Figure 24.24Pattern Repeating Routine ParametersCutting feedRapid feed(start point)ZXShape defined byworkpiece contour blocksFinishing pass(I+K)/2(U+W)/2Note: Tool paths not to scale.In Figure 24.24, the contour blocks for this routine must define all motio...

  • Page 596

    Compounding Turning RoutinesChapter 2424-32Prevent this invalid cycle profile error by keeping the right portion of thefollowing equation less than the radius of any arcs in your cycle profile.R ² p (I+U)2 + (K+W)2 + (tool radius)The same basic equation can apply to other contours. If the length...

  • Page 597

    Compound Turning RoutinesChapter 2424-33The G75 routine can be programmed while the tool tip radiuscompensation mode (G41 or G42) is active. If tool tip radiuscompensation is active prior to the G75 block it remains active throughoutthe execution of the routine.The G75 roughing routine activates ...

  • Page 598

    Compounding Turning RoutinesChapter 2424-34When the G75 routine is executed in single block mode, the execution ofthe routine stops after each complete iteration of the routine (a total of Diterations are made).Example 24.8G75 Casting/Forging Roughing RoutineN11 G00X100.Z175.;N12 G75P14Q20I8.K12....

  • Page 599

    Compound Turning RoutinesChapter 2424-35The G72 finish routine is normally executed after the completion of acontouring routine (G73, G74 or G75). With the G73, G74, and G75routines a finish allowance is left on the workpiece if a U- and/or K-wordis specified in the routine. The G72 routine is us...

  • Page 600

    Compounding Turning RoutinesChapter 2424-36In Example 24.9, the workpiece contour blocks are blocks N11 - N14.Example 24.9Typical G72 Block Followed by Blocks Defining Final ContourN005 G72P11Q14;...N010 M30.;N011 X24.;N012 X55.Z40.;N013 X65.Z35.;N014 X70.Z5.;The G72 routine can be programmed whi...

  • Page 601

    Chapter2525-1Thread CuttingThe 9/Series control provides two methods of thread cutting:Single-pass thread cuttingG33 and G34 blocks generate a single thread cutting pass. G33 can cutstraight, tapered, face, multistart, and multiblock threads. G34 can cutthread passes of increasing or decreasing l...

  • Page 602

    Thread CuttingChapter 2525-2When performing threading operations, remember:Emergency Stop - Pressing the emergency stop during threading causesall axes to come to a rapid stop. This likely causes damage to the part ortool and resuming the threading moves is not possible.<CYCLE STOP> (cycle ...

  • Page 603

    Thread CuttingChapter 2525-3Axis feedrates - When threading, the speed of the cutting axis isdetermined by the controlling spindle speed and the thread lead throughthis equation:axis feedrate= (S) / (F inches per revolution)= (S) / (E threads per inch)= (S)(E inches per thread)Where :Is :Sthe act...

  • Page 604

    Thread CuttingChapter 2525-4Figure 25.1Angular versus Plunge InfeedCutting toolCutting toolAngular InfeedPlunge InfeedThe G78 threading pass allows the selection of different infeed types byprogramming a P-word. If you use any of the other threading methods,it is necessary to insert a small Z mov...

  • Page 605

    Thread CuttingChapter 2525-5Important: This feature may only be used with the G78 or G21 threadingcycle. It is ignored if a G33 or G34 threading pass is being made.Using Thread RetractEnabled in PAL, thread retract lets you interrupt a thread cutting operationwithout damaging the thread by pressi...

  • Page 606

    Thread CuttingChapter 2525-6The G33 thread cutting mode can cut straight, tapered, face, and multistartthreads that have constant thread leads (use G34 to cut threads that do nothave a constant lead). The G33 thread cutting mode is a mode, not a cycleand does not generate any extra motion blocks....

  • Page 607

    Thread CuttingChapter 2525-7Where :Is :XThis parameter is the end point of the thread cutting move in the X axis. This parameter may be an incremental or absolute and radius ordiameter value. If not present there must be a Z parameter. If an X parameter is present, it indicates either a face, tap...

  • Page 608

    Thread CuttingChapter 2525-8Example 25.1Parallel Thread CuttingThread lead: 5 threads/inch (.20 inch pitch)Depth of cut:.7 inch (after final pass)Number of cutting passes: 2N1 M03 S50;N2 G00 X1.5 Z2.2;N3 X.9;N4 G33 Z.8 F.2;N5 Z.5 X1.2N6 G00 X1.5;N7 Z2.2;N8 X.7;N9 G33 Z.8 F.2;N10 Z.5 X1.2N11 G00 X...

  • Page 609

    Thread CuttingChapter 2525-9The programmed lead remains in effect until another thread lead value isprogrammed, the control is reset, or an M02 or M30 end of program blockis executed.For tapered threads, the thread lead (determined by the F- or E-word) isapplied along the axis that travels the gr...

  • Page 610

    Thread CuttingChapter 2525-10Example 25.2Tapered Thread CuttingThread lead: .125 threads/mm (8 mm pitch)Depth of cut: 1 mm (X direction)Number of cutting passes: 2N1 M03 S30;N2 G77 G00 X20. Z4.;N3 G33 X48. Z-47. F8;N4 X52 Z-55;N5 G00 X60.;N6 Z4.;N7 X12.;(second pass)N8 G33 X40. Z-47.;N9 X52 Z-55;...

  • Page 611

    Thread CuttingChapter 2525-11Example 25.3Multistart Thread CuttingThread lead: 2 threads/inch (.50 inch pitch)Depth of cut:.7 inch (after final pass)Number of cutting passes: 2 at 180 degrees apartN1 M03 S50;N2 G00 X1.5 Z2.2;N3 X.9;N4 G33 Z.8 E2. Q0;N5 Z.5 X1.2N6 G00 X1.5;N7 Z2.2;N8 X.9;N9 G33 Z....

  • Page 612

    Thread CuttingChapter 2525-12The G34 code programs the variable lead thread cutting mode. It isprogrammed almost identically to the G33 thread cutting mode with theaddition of a K-word used to program the amount of lead variation perrevolution.Figure 25.9Variable Lead ThreadImportant: Do not re-p...

  • Page 613

    Thread CuttingChapter 2525-13Where :Is :E FThis parameter may be entered by using either an E- or F-word. It represents thethread lead along the axis with the largest programmed distance to travel tomake the thread cut. It is mandatory when cutting any threads.If the E-word is programmed, its val...

  • Page 614

    Thread CuttingChapter 2525-14Metric and inch Lead variation limits are indicated below:+/- 0.0001to+/- 100.0000 mm/rev+/- 0.000001 to+/- 1.000000 inch/revExample 25.4Variable Lead Face Threading Using G34N1G00G07X57.Z37.5F100;N2G91;N3G34X-47.5F.1K.071;N4G00Z10.;N5X47.5;

  • Page 615

    Thread CuttingChapter 2525-15Figure 25.11Results of Variable Lead Face Threading Example37.5Z37.59.557.047.5mm.171 mm/revZ57.0.1 mm/revX.171 mm/rev.526 mm/rev

  • Page 616

    Thread CuttingChapter 2525-16The G21 single pass threading cycle can be programmed to cut parallel ortapered fixed lead threads (variable lead threads may only be cut using aG34 block). This threading cycle performs a predetermined series ofmachining steps designated by a single program block.The...

  • Page 617

    Thread CuttingChapter 2525-17When this cycle is executed:1.The cutting tool rapids to the depth programmed with the X-word.2.The thread cutting pass is made to the position programmed with theZ-word using a feedrate that generates the required lead programmedwith the E- or F-word. If the Thread C...

  • Page 618

    Thread CuttingChapter 2525-18Figure 25.12Results of G21 Straight Thread Cutting ExampleZX4.34.810.00.5 lead10.05.0Taper Thread CuttingThis format is for programming a single pass tapered threading cycle:G21X__Z__I__F__ ;EWhere :Is :XThis parameter is the end point of the thread cutting move in th...

  • Page 619

    Thread CuttingChapter 2525-19Figure 25.13G21 Taper Thread Cutting ParametersZX Abs.X Inc.FZInc.ZAbs.IXWhen this cycle is executed:1.The cutting tool rapids to the depth programmed with the X-wordadded to the I value.2.The thread cutting pass is made to the position programmed with theX- and Z-wor...

  • Page 620

    Thread CuttingChapter 2525-204.The cutting tool is returned along the Z axis at a rapid feedrate to theZ axis position prior to the G21 block.5.Program execution continues on to the next block.G21 is modal. Following passes need to contain only a new value for theinfeed (X value). The other param...

  • Page 621

    Thread CuttingChapter 2525-21Programming Multipass Thread CuttingBefore programming the G78 threading routine, the cutting tool must bepositioned to the point from which the routine is to be executed. This pointis the end-point of each complete cycle of the threading routine’sexecution.Use this...

  • Page 622

    Thread CuttingChapter 2525-22If a straight thread is desired:enter a value of zero for this parameterordo not program the I-word in the blockThe control performs threading in either radius or diameter mode. Beaware that X values entered as a radius or a diameter value when entered.Z, I, K, and D,...

  • Page 623

    Thread CuttingChapter 2525-23Tool InfeedThis multipass threading routine provides 4 different types of cutting toolinfeed determined by a P-word in the threading block. These differentinfeeds are provided to allow operation with different types of cutting toolsand materials. These different infee...

  • Page 624

    Thread CuttingChapter 2525-24Figure 25.15Multipass Thread Cutting Infeed ParametersFinishingallowanceFinishingallowanceFinishingallowanceFinishingallowanceKKKKCuttingtoolCuttingtoolCuttingtoolCuttingtoolP1Single edgecuttingP3Single edge cuttingP4Double edgecuttingP2Double edgecuttingDDDDDDDDDÖ2D...

  • Page 625

    Thread CuttingChapter 2525-25Figure 25.16Sample Tool Paths for Multipass Threading Cycle (assumes P3)KAThese distances aredetermined by P-wordRapid MovesThreading MovesFinishingallowancePullout angleIDInfeed ReferencePointA/2END OF CHAPTER

  • Page 626

    Thread CuttingChapter 2525-26

  • Page 627

    Chapter2626-1Drilling CyclesThis chapter covers the G-word data blocks in the drilling cycle group.The operations of the drilling cycles are explained on these pages:Topic:Page:Drilling cycles26-1Positioning and Hole Machining Axes26-4Parameters26-7Drilling Cycle Operations26-8Altering Drilling C...

  • Page 628

    Drilling CyclesChapter 2626-2Table 26.ADrilling CyclesG-codeApplicationTool MovementOperation At Hole BottomRetraction MovementG80Cancel Or End Fixed CycleN/AN/AN/AG81Drilling Cycle,No Dwell/Rapid OutFeedRetractRapid TraverseG82Drilling Cycle,Dwell/Rapid OutFeedDwell / RetractRapid TraverseG83Dee...

  • Page 629

    Drilling CyclesChapter 2626-3In general, drilling cycles consist of the following operations (seeFigure 26.1):Figure 26.1Drilling Cycle OperationsCutting feedRapid feedR point levelInitial pointlevelPositioning toinitial pointRapid feed toR point levelMachiningOperations at hole bottomRapid retur...

  • Page 630

    Drilling CyclesChapter 2626-4This section assumes that the programmer can determine the holemachining axis using the plane select G-codes (G17, G18, G19). Refer tothe system installer’s documentation to make sure that a specific axis hasnot been selected in AMP to be the hole machining axis.G-c...

  • Page 631

    Drilling CyclesChapter 2626-5Figure 26.2 shows typical drilling cycle motions in absolute (G90) orincremental (G91) mode. Note the changes in how the R point and Z levelare referenced.Figure 26.2Drilling Cycle Parameters in G90 and G91 ModesCutting feedRapid feedZRZZRR point levelR point levelZG9...

  • Page 632

    Drilling CyclesChapter 2626-6Figure 26.3 shows the two different modes available for selecting thereturn level in the Z axis after the hole has been drilled. These two modesare selected with G98 (which returns to the same level the cycle started at)and G99 (which returns to the level defined by t...

  • Page 633

    Drilling CyclesChapter 2626-7This section provides a detailed explanation of each parameter you canprogram for the drilling cycles. Some parameters are not valid with allcycles; see the specific description of each cycle. To alter drilling cycleoperation parameters, see section 26.5.These drillin...

  • Page 634

    Drilling CyclesChapter 2626-8Drilling cycles G83.1, G84.1, G86.1 and G81-G89 are modal, whichmeans they remain active until you program a G-code that cancels thedrilling cycle. Certain drilling cycles can, therefore, be repeated atdifferent positions without having to re-program all the parameter...

  • Page 635

    Drilling CyclesChapter 2626-9The format for the G81 cycle is:G81X__Z__R__F__L__;Where :Is :Xspecifies location of the hole.Zdefines the hole bottom.Rdefines the R point level.Fdefines the cutting feedrate.Ldefines the number of times the drilling cycle is repeated.See page 26-7 for a detailed des...

  • Page 636

    Drilling CyclesChapter 2626-10In the G81 drilling cycle, the control moves the axes in this manner:1.The tool rapids to the initial point level above the hole location.2.The drilling tool then rapids to the R point level, slows to theprogrammed cutting feedrate and begins the drilling operation.3...

  • Page 637

    Drilling CyclesChapter 2626-11Figure 26.5G82: Drilling Cycle, Dwell/Rapid Out5Z34R21initial pointlevelR point levelHole bottomDwell at hole bottomCutting feedRapid feedIn the G82 drilling cycle, the control moves the axes in this manner:1.The tool rapids to initial point level point above the hol...

  • Page 638

    Drilling CyclesChapter 2626-12The format for the G83 cycle is:G83X__Z__R__Q__F__L__;Where :Is :Xspecifies location of the hole.Zdefines the hole bottom.Rdefines the R point level.Qdefines the infeed amount for each step into the hole.Fdefines the cutting feedrate.Ldefines the number of times the ...

  • Page 639

    Drilling CyclesChapter 2626-13In the G83 drilling cycle, the control moves the axes in this manner:1.The tool rapids to initial point level above the hole location.2.The drilling tool then rapids to the R point level, slows to theprogrammed cutting feedrate and begins the deep hole drillingoperat...

  • Page 640

    Drilling CyclesChapter 2626-14Figure 26.7G83.1: Deep Hole Peck Drilling Cycle with DwellR point levelHole bottomInitial pointlevelMoves to hole bottom when Q islarger than remaining depth7dd46QQ 3R215In the G83.1 peck drilling cycle, the control moves the axes in this manner:1.The tool rapids to ...

  • Page 641

    Drilling CyclesChapter 2626-156.After the drilling tool retracts an amount d, it then resumes drilling atthe cutting feedrate to a depth d + Q.This retraction and extension continues until the drilling tool reachesthe depth of the hole as programmed with the Z-word in the drillingcycle block.7.Th...

  • Page 642

    Drilling CyclesChapter 2626-16Figure 26.8G84: Right-Hand Tapping CycleInitial pointlevel76Spindle or live tool rotationin the forward direction5Hole bottomSpindle or live tool rotationdirection reversed at holebottom4Z 3R 21R point levelCutting feedRapid feedIn the G84 right-hand tapping cycle, t...

  • Page 643

    Drilling CyclesChapter 2626-174.If a value was programmed for the P parameter, the threading tooldwells after it reaches the bottom of the hole, and after the spindle hasbeen commanded to reverse.The spindle or live tool reverses to the counterclockwise direction.5.The threading tool retracts at ...

  • Page 644

    Drilling CyclesChapter 2626-18Important: When programming a G84 tapping cycle, remember:the programmer or operator must start spindle or live tool rotationoverride usage - the control ignores the feedrate override switch andclamps override at 100 percentduring tapping, the feedrate override switc...

  • Page 645

    Drilling CyclesChapter 2626-19CAUTION: The programmer or operator must set the directionof spindle rotation for tap-in. The control forces the properspindle direction for the tap-out, but uses the programmedspindle direction for the tap-in.1.The tool rapids to the initial point level above the ho...

  • Page 646

    Drilling CyclesChapter 2626-20Use this cycle to cut right-handed threads.The format for the G84.2 cycle is:G84.2X__Z__R__F__L__Q__D__S__;Where :Is :Xspecifies location of the hole.Zdefines the hole bottom.Rdefines the R point level.Fdefines the thread lead along the drilling axis (Z in this manua...

  • Page 647

    Drilling CyclesChapter 2626-21on a dual-process lathe, both processes can be in solid-tapping mode atthe same time assuming that they have separate controlling spindlesyou must disable CSS before performing solid tapping; an attempt toexecute the tap phase of a solid-tapping cycle with CSS result...

  • Page 648

    Drilling CyclesChapter 2626-22In the G84.2 right-hand solid-tapping cycle, the control moves the axes inthis manner:1.The tool rapids to the tapping position above the hole location.2.The threading tool then rapids to the R point.3.The control either orients or stops the spindle.If a Q-word was p...

  • Page 649

    Drilling CyclesChapter 2626-23Use this cycle to cut left-handed threads.The format for the G84.3 cycle is:G84.3X__Z__R__F__L__Q__D__S__;Where :Is :Xspecifies location of the hole.Zdefines the hole bottom.Rdefines the R point level.Fdefines the thread lead along the drilling axis (Z in this manual...

  • Page 650

    Drilling CyclesChapter 2626-24on a dual-process lathe, both processes can be in solid-tapping mode atthe same time assuming that they have separate controlling spindlesyou must disable CSS before performing solid tapping; an attempt toexecute the tap phase of a solid-tapping cycle with CSS result...

  • Page 651

    Drilling CyclesChapter 2626-25In the G84.3 left-hand solid-tapping cycle, the control moves the axes inthis manner:1.The tool rapids to the tapping position above the hole location.2.The threading tool then rapids to the R point.3.The control either orients or stops the spindle.If a Q-word was pr...

  • Page 652

    Drilling CyclesChapter 2626-26See page 26-7 for a detailed description of these parameters.Important: The programmer or operator must start spindle or live toolrotation.Figure 26.10G85: Boring Cycle (Without Dwell, Feed Out)Hole bottomR point levelInitial pointlevel51234Cutting feedRapid feedIn t...

  • Page 653

    Drilling CyclesChapter 2626-27The format for the G86 cycle is:G86X__Z__R__P__F__L__;Where :Is :Xspecifies location of the hole.Zdefines the hole bottom.Rdefines the R point level.Pdefines the dwell period at hole bottom.Fdefines the cutting feedrate.Ldefines the number of times the drilling cycle...

  • Page 654

    Drilling CyclesChapter 2626-28In the G86 drilling cycle, the control moves the axis in this manner:1.The tool rapids to the initial point level above the hole location.2.The cutting tool then rapids to the R point level, slows to theprogrammed cutting feedrate and begins the boring operation.3.Th...

  • Page 655

    Drilling CyclesChapter 2626-29Figure 26.12G86.1: Boring Cycle, Tool ShiftQSpindle or live tool orientedand tool shiftedShiftR point levelInitial pointlevel8712364QShift5Hole bottomSpindle orient afterdwell at Z point levelto position tool forremovalCutting feedRapid feedShiftBored holeIn the G86....

  • Page 656

    Drilling CyclesChapter 2626-30The shift direction is determined by two possible methods:Method IThis shift method is a single-axis shift. The direction and axis for the shiftis set in AMP by your system installer or can be altered using the drillingcycle parameter table. See page 26-38.the direct...

  • Page 657

    Drilling CyclesChapter 2626-31When using Method II, remember:the generated move is a single linear move and executes atThe format for the G87 back boring cycle is:G87X__Z__I__J__K__R__F__L__;Q__Where :Is :Xspecifies location of the hole.Zdefines the Z point level. The Z point level in this case i...

  • Page 658

    Drilling CyclesChapter 2626-32Figure 26.13G87: Back Boring CycleHole bottomZ point levelInitial pointlevelSpindle or live toolorientationSpindle or live toolrotation forwardSpindle or live toolorientation12876534Cutting feedRapid feedIn the G87 back boring cycle, the control moves the axes in thi...

  • Page 659

    Drilling CyclesChapter 2626-33Method IThis shift method is a single axis shift. The direction and axis for theshift is set in AMP by the system installer or can be altered using thedrilling cycle parameter table. See page 26-38.the direction of the axis is specified as + or -the feedrate using th...

  • Page 660

    Drilling CyclesChapter 2626-346.After reaching the Z depth, the spindle or live tool rotation stops sothat the control can re-orient the back boring tool to the positionspecified in AMP.The back boring tool is shifted a third time, in the same manner as instep 2, so that it is again “off-center...

  • Page 661

    Drilling CyclesChapter 2626-35Figure 26.14G88: Boring Cycle, Spindle Stop/Manually OutR point levelInitial pointlevelHole bottomCycle startSpindle rotation inthe forward direction6571R2Z 34Spindle or live tool stops athole bottom after dwellCutting feedRapid feedManual operationIn the G88 boring ...

  • Page 662

    Drilling CyclesChapter 2626-366.The boring tool is then retracted at a rapid feedrate to initial pointlevel, as determined by G98.7.At this point, the rotation of the spindle or live tool changes to theclockwise direction.When the single block function is active, the control stops axis motionafte...

  • Page 663

    Drilling CyclesChapter 2626-37Figure 26.15G89: Boring Cycle, Dwell/Feed OutR point levelHole bottomRZ123Dwell456Cutting feedRapid feedInitial pointlevelIn the G89 boring cycle, the control moves the axes in this manner:1.The tool rapids to initial point level above the hole location.2.The boring ...

  • Page 664

    Drilling CyclesChapter 2626-38The system installer determines many parameter for the drilling cycles inAMP. For details on these cycles, see page 26-4 or chapters 22 -- 25.These 3 parameters may also be changed by the operator by using theDrilling Cycle Parameter screen:G83.1 Deep Hole Peck Drill...

  • Page 665

    Drilling CyclesChapter 2626-392.Press the {PRGRAM PARAM} softkey.(softkey level 2)PRGRAMPARAMAMPDEVICESETUPMONI-TORTIMEPARTSPTOMSI/OEMSYSTEMTIMING3.Press the {DRLCYC PARAM} softkey. The Drilling CycleParameter screen is displayed. Figure 26.16 shows a typical DrillingCycle Parameter screen.(softk...

  • Page 666

    Drilling CyclesChapter 2626-404.From this screen select the parameter that it is desired to change bypressing the up or down cursor keys. The selected parameter isshown in reverse video.5.There are two options:To replace the current value of the parameter with a new value,key in the new value on ...

  • Page 667

    Drilling CyclesChapter 2626-41Example 27.3Programming G83, Deep Hole Drilling Cycle in Absolute ModeN10G90 G00 X5 Y12 Z0 G17 F200;N20G83 X1 Y10 Z-5 R-2 Q1.5;N30X5 Y5 Z-8;N40X9 Y10 Z-5;N50M30;Figure 26.17Result of Example 27.2 and Example 27.3Second Hole90°SpindleFirst HoleN30( 5,3 )( 5,0 )N20N50...

  • Page 668

    Drilling CyclesChapter 2626-42

  • Page 669

    Chapter2727-1Skip and Gauge Probing CyclesThis chapter describes the external skip and gauging functions available onthe 9/Series control. External skip functions are motion generating G-codeblocks that can be aborted when the control receives an external signalthrough the PAL program. Gauging fu...

  • Page 670

    Skip and Gauge Probing CyclesChapter 2727-2CAUTION: We do not recommend using a skip block from anyfixed cycle block (such as drilling or turning). If you do chooseto execute a skip block in a fixed cycle mode, be aware that theblock that is skipped when the trigger occurs can be a cyclegenerated...

  • Page 671

    Skip and Gauge Probing CyclesChapter 2727-3Important: The move that immediately follows a G31 series external skipblock cannot be a circular move.The coordinates of the axes when the external skip signal is received areavailable as the paramacro system parameters #5061--#5066 (workcoordinate syst...

  • Page 672

    Skip and Gauge Probing CyclesChapter 2727-4The format for any G37 skip blocks is:G37 Z__ F__;Where :Is :G37Corresponds to any of the G-codes in the G37 series. Use the one that isconfigured to respond to the current skip signal device that is being used.X, ZThe axis on which the length offset mea...

  • Page 673

    Skip and Gauge Probing CyclesChapter 2727-5Important: The move that immediately follows a G37 series skip blockcannot be a circular move.The system installer determines in AMP if the new value is added to orreplaces the old value in the table. The system installer also determines inAMP what gauge...

  • Page 674

    Skip and Gauge Probing CyclesChapter 2727-6Figure 27.1Typical Tool Gauging ConfigurationsProbeProberadiusToolProbeProberadiusToolProbeProberadiusProbelengthToolCase 1Case 2Case 3+ Z--X--XFigure 27.1 illustrates 3 typical tool gauging configurations. All 3 casesassume that the probe is at a known,...

  • Page 675

    Chapter2828-1ParamacrosThe Paramacrost feature is similar to a subprogram with many addedfeatures. Special features available with a paramacro include:Computable variablesComputable word address fields in any block typeVariable to and from PALAccess to certain modal system parameters for computat...

  • Page 676

    ParamacrosChapter 2828-2It may be necessary for mathematical expressions to be evaluated in acomplex paramacro. This requires that some form of mathematicalequation be written in a paramacro block. The following is a discussion ofthe operators and function commands available for use on the contro...

  • Page 677

    ParamacrosChapter 2828-3Example 28.1Mathematical OperationsExpression enteredResult12/4*3912/[4*3]112+2/213[12+2]/2712-4+31112-[4+3]5All logical operators have the format of:A logical operator Bwhere A and B are numerical data or a parameters with a value assigned.If B is negative in the above fo...

  • Page 678

    ParamacrosChapter 2828-4This subsection lists the basic mathematical functions that are available onthe control and their use. Use these functions to accomplish mathematicaloperations that are necessary to evaluate the trigonometric and othercomplex mathematical equation such as rounding off, squ...

  • Page 679

    ParamacrosChapter 2828-5Example 28.3Format for FunctionsSIN[2]This evaluates the sine of 2 degrees.SQRT[14+2]This evaluates the square root of 16.SIN[SQRT[14+2]]This evaluates the sine of the square root of 16.LN[#2+4]This evaluates the logarithm of the value of parameter #2 plus 4.Example 28.4Ma...

  • Page 680

    ParamacrosChapter 2828-6You can use parametric expressions to specify G-codes or M-codes in aprogram block.For example:G#1 G#100 G#500 M#1 M#100 M#500;G#520 G[#521-1] G[#522+10] M#520 M[#522+1] M[#522+10];When using a parametric expression to specify a G-- or M-code, remember:When specifying more...

  • Page 681

    ParamacrosChapter 2828-7Use transfer of control commands to alter the normal flow of programexecution. Normally the control executes program blocks sequentially.By using control commands, the programmer can alter this normal flow ofexecution and transfer execution to a specific block or begin loo...

  • Page 682

    ParamacrosChapter 2828-8Program a condition between the [ and ] brackets in this format:[A EQ B]where A and B represent some numerical value. The values for A and Bcan be in the form of some mathematical equation or in the form of aparamacro parameter.Example 28.6Evaluation of Conditional Express...

  • Page 683

    ParamacrosChapter 2828-9Example 28.7Unconditional GOTON1...;N2...;N3GOTO5;N4...;N5...;N6...;/N7GOTO1;In Example 28.7, execution continues sequentially until block N3 is read;then execution transfers to block N5 and again resumes sequentialexecution to block N6. If optional block skip 1 is off, bl...

  • Page 684

    ParamacrosChapter 2828-10When block N2 is read, parameter #3 is compared to the value -1.5. If thecomparison is true, then blocks N3 and N4 are skipped, and executioncontinues on from block N5. If the comparison is false, then executioncontinues to block N3. When block N6 is read, parameter #4 is...

  • Page 685

    ParamacrosChapter 2828-11Use this format for the WHILE-DO-END command:WHILE [ (condition) ] DO m;;;;END m;Where :Is :(condition)some mathematical condition. This condition is tested by the control todetermine if it is true or false.man identifier used by the control to relate a DO block with an E...

  • Page 686

    ParamacrosChapter 2828-12Example 28.10Nested WHILE DO CommandsN1#1=1;N2WHILE[#1LT10]DO1;N3#1=[#1+1];N4WHILE[#1EQ2]DO2;N5...;N6END2;N7END1;N8...;In Example 28.10, blocks N2 through N7 are repeated until the conditionin block N2 becomes false. Within DO loop 1, DO loop 2 will be repeateduntil the c...

  • Page 687

    ParamacrosChapter 2828-13Local parameters are used in a specific macro to perform calculations andaxis motions. After their initial assignment, these parameters can bemodified within any macro at the same nesting level. For example macroO11111 called from a main program has 33 local parameter val...

  • Page 688

    ParamacrosChapter 2828-14Example 28.11Assigning Using More Than One I, J, K SetG65P1001K1I2J3J4J5;The above block sets the following parameters:parameter #6 = 1parameter #7 = 2parameter #8 = 3parameter #11 = 4parameter #14 = 5If the same parameter is assigned more than one value in an argument, o...

  • Page 689

    ParamacrosChapter 2828-15The common parameters refer to parameter numbers 100 to 199 and 500 to999 for all 9/Series controls except for the 9/240, which allows 100 to 199and 500 to 699. The common parameters are assigned through the use of acommon parameter table as described on page 28-38.Common...

  • Page 690

    ParamacrosChapter 2828-16Table 28.DSystem ParametersParameter #System ParameterPage2001 to 2999Tool Offset Tables28-1730002 Program Stop With Message (PAL)28-173001System Timer (PAL)28-183002System Clock28-1830032 Block Execution Control 128-1930042 Block Execution Control 228-1930062 Program Sto...

  • Page 691

    ParamacrosChapter 2828-17Table 28.D (continued)System ParametersParameter #System ParameterPage5731 to 5743Home Marker Distance28-315751 to 5763Home Marker Tolerance28-311 These parameters may only have their value received (read-only)2 These parameters may only have their value changed (write-on...

  • Page 692

    ParamacrosChapter 2828-18When the control executes this block, a cycle stop is performed and themessage “SEE PART PROGRAM FOR MACRO STOP MESSAGE” isdisplayed on line 1 of the CRT. This is intended to point out to theoperator an important comment in the program block that assigns a valueto par...

  • Page 693

    ParamacrosChapter 2828-19#3003Block Execution Control 1Use this parameter to control whether the control ignores single-blockmode and to control when M-codes are executed in a block. The value ofthis parameter ranges from 0 to 3, and it is a write-only parameter.These results occur when parameter...

  • Page 694

    ParamacrosChapter 2828-20#3006Program Stop With MessageUse this parameter to cause a cycle stop operation and display a messageon line 1 of the CRT. Any block that assigns a new value to the parameter3006 will result in a cycle stop. Any decimal value may be assigned to thisparameter the value of...

  • Page 695

    ParamacrosChapter 2828-21This parameter reflects both the programmed and front-panel (externalmirror) status of mirroring on the axes.#4001 to 4120Modal InformationThese are read-only parameters. They indicate the value of a modalprogram word. NO TAG shows the modal program word that applies toth...

  • Page 696

    ParamacrosChapter 2828-22#5001 to 5012Coordinates of End PointThese parameters are read-only. They correspond to the coordinates of theend point (destination) of a programmed move. These are the coordinatesin the work coordinate system.5001Axis 1 coordinate position5007Axis 7 coordinate position5...

  • Page 697

    ParamacrosChapter 2828-23#5041 to 5052Machine Coordinate PositionThese parameters are read-only. They correspond to the coordinates of thecutting tool in the machine (absolute) coordinate system.5041Axis 1 coordinate position5047Axis 7 coordinate position5042Axis 2 coordinate position5048Axis 8 c...

  • Page 698

    ParamacrosChapter 2828-24#5071 to 5079 or #5561 to 5562Skip Signal Position Machine Coordinate SystemThese parameters are read-only. They correspond to the coordinates of thecutting tool when a skip signal is received to PAL from a probe or otherdevice such as a switch. These are the coordinates ...

  • Page 699

    ParamacrosChapter 2828-25#5081 to 5089 or #5581 to 5592 Active Tool Length OffsetsThese are read-only parameters. They correspond to the currently activetool length offsets (see chapter 20).5081Current axis 1 tool length offset.5087Current axis 7 tool length offset.5082Current axis 2 tool length ...

  • Page 700

    ParamacrosChapter 2828-26The system installer determines in AMP the name (or word) that is used todefine the axis. The following error of a system constantly changes. Youcan use this parameter to take a “snapshot” of the following error, but thevalue that is read may not the current following...

  • Page 701

    ParamacrosChapter 2828-275241G55 Axis 1 Coordinate5341G59.1 Axis 1 Coordinate5242G55 Axis 2 Coordinate5342G59.1 Axis 2 Coordinate5243G55 Axis 3 Coordinate5343G59.1 Axis 3 Coordinate5244G55 Axis 4 Coordinate5344G59.1 Axis 4 Coordinate5245G55 Axis 5 Coordinate5345G59.1 Axis 5 Coordinate5246G55 Axis...

  • Page 702

    ParamacrosChapter 2828-285301G58 Axis 1 Coordinate5302G58 Axis 2 Coordinate5303G58 Axis 3 Coordinate5304G58 Axis 4 Coordinate5305G58 Axis 5 Coordinate5306G58 Axis 6 Coordinate5307G58 Axis 7 Coordinate5308G58 Axis 8 Coordinate5309G58 Axis 9 Coordinate5310G58 Axis 10 Coordinate5311G58 Axis 11 Coord...

  • Page 703

    ParamacrosChapter 2828-29#5651 to 5662Deceleration Ramps for Linear Acc/Dec ModeThese parameters are read only. They correspond to the active decelerationramps in Linear Acc/Dec mode. You can set these parameters byprogramming a G48.2 in your part program block. Control Reset, ProgramEnd (M02/M03...

  • Page 704

    ParamacrosChapter 2828-30#5691 to 5702Deceleration Ramps for S- Curve Acc/Dec ModeThese parameters are read only. They correspond to the active decelerationramps in S--Curve Acc/Dec mode. You can set these parameters byprogramming a G48.4 in your part program block. Control Reset, ProgramEnd (M02...

  • Page 705

    ParamacrosChapter 2828-31#5731 to 5743Home Marker DistanceThese parameters are read only. They correspond to the current home markerdistance. These parameters will contain the distance to marker calculatedwhen the axis stopped after the home switch went false during the lasthoming operation.5731A...

  • Page 706

    ParamacrosChapter 2828-32Input Flags:There are 4-integer or 3-integer and 32-bit pattern input parametersavailable. The part program may only read the values assigned to theseparameters; it may not write values to them. The paramacro inputparameters available to the part programmer are:#1000 -- #...

  • Page 707

    ParamacrosChapter 2828-33Output flags should not be used as Input flags unless absolutely necessary.This is because the operator/programmer has the ability to inadvertentlywrite data to the Output flags, whereas the Input flags cannot be written tofrom the control.Output flags are broken into fou...

  • Page 708

    ParamacrosChapter 2828-34All shared dual-process parameters are saved at power-down. This meansthat they retain their value even after power to the control is lost.Synchronization Problems with Shared Dual-Process ParametersThe programmer must concern himself with timing when changing dualprocess...

  • Page 709

    ParamacrosChapter 2828-35Table 28.HArgument Assignments(A)(B)WordAddressParameterAssignedI, J, KSet #WordAddressParameterAssignedA#11I#4B#2J#5C#3K#6D#72I#7E#8J#8F#9K#9H#113I#10I*#4J#11J*#5K#12K*#64I#13M#13J#14Q#17K#15R#185I#16S#19J#17T#20K#18U#216I#19V#22J#20W#23K#21X#247I#22Y#25J#23Z#26K#248I#25...

  • Page 710

    ParamacrosChapter 2828-36To enter a value for a parameter # using an argument, enter the wordcorresponding to the desired parameter number in a block that calls aparamacro (for legal argument locations, see specific formats for callingthe macro) followed by the value to assign that parameter. For...

  • Page 711

    ParamacrosChapter 2828-37Example 28.15Assigning Parameters:#100=1+1;#100=5-3;#100=#3;#100=#7+1;#100=#100+1;You can also assign multiple paramacro parameters in a single block. In amultiple assignment block, each assignment is separated by a comma. Forexample:#1=10,#100=ROUND[#2+#3],#500=10.0*5;If...

  • Page 712

    ParamacrosChapter 2828-38Direct Assignment Through TablesUse this feature to view or set common parameters and view localparameters. Assignment through tables is generally used to edit commonparameters.To edit the values of the common parameters or view the local parameters,follow these steps.1.P...

  • Page 713

    ParamacrosChapter 2828-39If viewing the local parameter table, do not continue to step 3. If editingone of the common parameter tables, move on to step 3.(softkey level 3)LOCALPARAMCOM-1PARAMCOM-2APARAMCOM-2BPARAM3.Select a parameter to change by moving the cursor to the desiredparameter number. ...

  • Page 714

    ParamacrosChapter 2828-405.If the {COM-2A PARAM}softkey has been pressed (in step 2),additional softkeys will be available to alter the parameter name.Select and complete the appropriate step to alter the commonparameter names. The 3 options include:To edit an existing parameter name or enter a p...

  • Page 715

    ParamacrosChapter 2828-41Addressing Assigned ParametersOnce you assign a parameter you can address it in a program:Example 28.16Addressing Assigned Parameters#100=5;#105=8;G01X#100+5 ;Axis moves to 10.G01x[#100+5]Axis moves to 8You can also indirectly address parameters with other parametersExamp...

  • Page 716

    ParamacrosChapter 2828-422.Enter a name for the backup file and press [TRANSMIT].The system verifies the file name and backs up the selectedparameters into a part program. You can restore these parameters byselecting and executing that part program.Important: If part program calculations cause an...

  • Page 717

    ParamacrosChapter 2828-43CAUTION: Any edits that are made to a subprogram, or to aparamacro program (as discussed in chapter 5) that has alreadybeen called for automatic execution, are ignored until the callingprogram is disabled and reactivated. Subprograms and paramacrosare called for automatic...

  • Page 718

    ParamacrosChapter 2828-44Use this format for calling a paramacro using the G66 command:G66 P_ L_ A_ B_;Where :Is :PIndicates the program number of the called macro. P ranges from 1 - 99999.LPrograms the number of times the macro will be executed after each motion blockthat follows the G66. L rang...

  • Page 719

    ParamacrosChapter 2828-45Unlike nonmodal macro calls, the G66 macro call repeats automaticallyafter any axis move until cancelled by a G67 block. This also applies tonested macros. When the control begins execution of the nested macro1002 in the program below, each axis move in the nested macro a...

  • Page 720

    ParamacrosChapter 2828-46Important: When the control executes block N040, the original value asset in block N020 for parameter number 1 is ignored, and the most currentvalue (1.7) is used. The first time macro 1001 is executed, Z moves 1.1units. The second time macro 1001 is executed, Z moves 1.7...

  • Page 721

    ParamacrosChapter 2828-47The L--word or any optional argument statements following a G66.1 cancontain any valid mathematical expression. For example:G66.1 P1002 L[#1+1] A[12*6] B[SIN[#101]];Example 28.20G66.1 Macro OperationN0100G90G17G00;N0110G66.1P9400;Macro 9400 is executed.N0120G91G18G01;G91 ...

  • Page 722

    ParamacrosChapter 2828-48Use this format for calling an AMP-defined macro:G_ A_ B_;Where :Is :G_Programs an AMP-defined G-code command (from G1 to G255.9).A-ZOptional argument statements. May be programmed using any letter from A to Zexcluding G, L, N, O, or P. Used to assign numeric values to pa...

  • Page 723

    ParamacrosChapter 2828-49Use this format for calling an AMP-defined M-code macro:M255 A_B_Where :Is :M255Programs an AMP-defined M-code command.A-ZOptional argument statements. May be programmed using any letter from A to Zexcluding G, L, N, O, or P. Used to assign numeric values to parameters in...

  • Page 724

    ParamacrosChapter 2828-50These macros are executed only as non-modal macro.The execution of the T--, S--, or B--code macro calls is the same as M-codemacro calls with the following exceptions:the parameter # referenced when calledthe macro program calledT calls macro 9000S calls macro 9029B calls...

  • Page 725

    ParamacrosChapter 2828-51Precautions must be taken when attempting to nest AMP assigned macrocalls since many combinations of these calls may not be valid. The systeminstaller determines in AMP the functionality of the AMP-defined macrocall when nested. These two options are available (see the sy...

  • Page 726

    ParamacrosChapter 2828-52Table 28.JWorks as the System-defined CodeCALLING PROGRAMTYPE OF MACRO NESTED 1G65,G66,orG66.1AMP-GAMP-MAMP-TS or BG65, G66 or G66.1YesYesYesYesAMP G-codeYesNoNoNoAMP M-codeYesNoNoNoAMP-T--, S--, or B--codeYesNoNoNo1 What Yes/No means:Yes---- the macro type across the top...

  • Page 727

    ParamacrosChapter 2828-53POPENThis command affects a connection to the output device by sending a DC2control code and a percent character “%” to the RS-232 interface. Thiscommand must be specified prior to outputting any data. After thiscommand, the control outputs any following program block...

  • Page 728

    ParamacrosChapter 2828-54Example 28.22 would yield an output equal to the character strings withthe * symbols being converted to spaces and the parameter values forparameters #123 and #234. The value of the parameter is output in binaryas a 32-bit string with the most significant bit output first...

  • Page 729

    ParamacrosChapter 2828-55There may be as many S and #P in a block as desired provided that thelength of the block does not exceed the maximum block size.Example 28.24Sample of a DPRNT BlockDPRNT[INSTALL*TOOL*#123[53]*PRESS*CYCLE*STOP**#234[20]];Example 28.24 would yield an output equal to the cha...

  • Page 730

    ParamacrosChapter 2828-56

  • Page 731

    Chapter2929-1Program InterruptThis chapter describes the program interrupt feature. This feature lets youexecute a subprogram or paramacro program while some other program isexecuting. This subprogram or paramacro is executed when PAL receivesan interrupt signal (usually through the use of some s...

  • Page 732

    Program InterruptChapter 2929-2An error is generated if anything other than an N-word, a P- or L-word, ablock delete /, or a comment character is programmed in the M96 or M97block.An interrupt M-code M96 or M97 may also be programmed within ainterrupt program. If this is the case the interrupt do...

  • Page 733

    Program InterruptChapter 2929-3The subprogram or paramacro program is assigned to a particular type ofinterrupt by programming a P-word in the M block that enables theinterrupt (M96 in this manual). When selecting a program with a P-word,only the numeric value of the program name is entered; the ...

  • Page 734

    Program InterruptChapter 2929-4The system installer determines:- in AMP, if a signal to execute an interrupt program is delayeduntil the end of a currently executing block, or executedimmediately.- in AMP, whether an interrupt program request is recognizedwhen an interrupt switch is turned on, or...

  • Page 735

    Program InterruptChapter 2929-5An Interrupt:- requested when the control is in E-Stop is ignored, regardless ofwhether the interrupt is enabled or not.- can only be executed when the control is in the <CYCLE START>state.If a request for an interrupt is made when the control is in<CYCLE S...

  • Page 736

    Program InterruptChapter 2929-6Type 1 InterruptsIf the Interrupt Program:Then the Control:Does not generate axis motionexecutes the interrupt program and thencontinues executing the part program asnormal regardless of the location thatthe interrupt program was executed.Generates axis motionreturn...

  • Page 737

    Program InterruptChapter 2929-7Type 2 InterruptsThe control returns the tool to the point in the program where it was whenthe interrupt was performed by using type 2 interrupts. Normally the first4 linear moves (G00 or G01) in the interrupt program are remembered.This may be altered by programmin...

  • Page 738

    Program InterruptChapter 2929-8You can alter the number of blocks that the control re-executes in reversewhen returning to the start position of the interrupt. The number of returnblocks is normally 4; however, it can be altered by these codes:M-code:Number ofBlocks Retraced:M900zeroM901oneM902tw...

  • Page 739

    Program InterruptChapter 2929-9The system installer determines if an interrupt program is to be called asa paramacro or a subprogram when it executes.If it is Called:Then:A ParamacroThis assigns a new set of local parameters for theinterruptA SubprogramThe same set of local parameters that applie...

  • Page 740

    Program InterruptChapter 2929-10

  • Page 741

    Chapter3030-1Using a 9/Series Dual-Processing SystemRead this chapter to learn general information related to programming andoperating a dual-processing system. Major topics in this chapter cover:Topic:On page:Definition of a dual-processing system30-1Operating a dual-processing system30-2Synchro...

  • Page 742

    Chapter 30Using a 9/Series Dual--Processing System30-2Dual-process systems operate almost exactly the same as theirsingle-process counterparts. Each process functions as an independent9/Series control.With the exception of shared dual-processing paramacro parameters, thereis little shared data be...

  • Page 743

    Chapter 30Using a 9/Series Dual--Processing System30-3You cannot switch the active process while you use the digitize feature, atool path or QuickCheck graphic display, or within an active programsearch operation. If you attempt to switch the active process, the controldisplays an error message. ...

  • Page 744

    Chapter 30Using a 9/Series Dual--Processing System30-4Editing a Part ProgramAn “E” next to the program name on the part program directory screenindicates that the program is currently being edited. Only one program canbe open for editing at a time. You cannot edit programs in more than onepro...

  • Page 745

    Chapter 30Using a 9/Series Dual--Processing System30-5You can use QuickCheck as a program “syntax only” checker(no graphics) in both processes at the same time.Error MessagesThe control displays error messages on the screen for only the currentlyactive process (except on split-screens). The n...

  • Page 746

    Chapter 30Using a 9/Series Dual--Processing System30-6Reset OperationsDual-process systems have a process reset operation, in addition to thenormal block reset and control reset functions. These reset operationswork as follows:If you want toperform a:Press:The control will:Block Reset[RESET]Skip ...

  • Page 747

    Chapter 30Using a 9/Series Dual--Processing System30-7On some machines or systems, it is often necessary to synchronize theoperations of 9/Series dual processes. For example, on a dual-turret lathe,if one turret must rough a shaft down to size before another turret beginscutting a thread, it is e...

  • Page 748

    Chapter 30Using a 9/Series Dual--Processing System30-8Synchronization M-codes are not allowed in the last block in the partprogram. This can cause the part program to pause indefinitely, waitingfor the next part program block (which does not exist) to become active.Synchronization M-codes are ign...

  • Page 749

    Chapter 30Using a 9/Series Dual--Processing System30-9Example 30.2Incorrect Use of Simple Synchronization with Shared ParamacroParametersProcess 1CommentProcess 2CommentN17 #7100=100;Paramacro parameter 7100 is set to 100N32 M100;Process pauses waiting for M100 inprocess 1. Block N33 is set up in...

  • Page 750

    Chapter 30Using a 9/Series Dual--Processing System30-10Coordinating Synchronization Between ProcessesRemember that both processes are executing coordinated part programs.Failing to coordinate part programs correctly can result in the processesexecuting different synchronization codes and mutually...

  • Page 751

    Chapter 30Using a 9/Series Dual--Processing System30-11Synchronization in MDI ModeSynchronization M-codes can be programmed in MDI mode. These canprove useful when attempting to manually start multiple programs fromsome point other than the beginning or when it is necessary to executeMDI programs...

  • Page 752

    Chapter 30Using a 9/Series Dual--Processing System30-12For example, press <CYCLE STOP>to place process 1 in cycle suspendmode, while process 1 is waiting for process 2 to execute an M101. Later,when you request <CYCLE START>for process 1, the synchronizationM-code is re-activated and ...

  • Page 753

    Chapter 30Using a 9/Series Dual--Processing System30-13Shared spindle configurations are for those dual-processing systems thathave one spindle that must be controlled by both processes. SeeFigure 30.4. As a general rule for this type of machine, spindle control isgiven to the process currently r...

  • Page 754

    Chapter 30Using a 9/Series Dual--Processing System30-14Use the synchronization M-codes to properly dictate which process hascontrol of the spindle at any given time. Adding a synchronization M-codeto the above program segments would remedy the problem of process 1cutting at the wrong RPM and in t...

  • Page 755

    Chapter 30Using a 9/Series Dual--Processing System30-15An error is generated and the process enters cycle stop if you attempt toactivate one of these features while one is already active in anotherprocess. For example, if process 1 is currently performing virtual C on theshared spindle and proces...

  • Page 756

    Chapter 30Using a 9/Series Dual--Processing System30-16Figure 30.5Multi-Start Thread When Same Start Point Is UsedProcess 11st Threading PassProcess 22nd Threading PassIf both processes key off samemarker pulse, then multi-start threadresults.Marker12600-IUse this formula to calculate the amount ...

  • Page 757

    Chapter 30Using a 9/Series Dual--Processing System30-17Figure 30.6Identical Thread Is Cut When Start Point Is Shifted Using EquationProcess 11st Threading PassProcess 22nd Threading PassMarker.02512601-IExample 30.6Threading on Both Processes with a Shared SpindleProcess 1CommentProcess 2CommentN...

  • Page 758

    Chapter 30Using a 9/Series Dual--Processing System30-18Figure 30.7Cutting a Thread Using Both ProcessesProcess 11st Threading PassProcess 22nd Threading Pass12602-ISpindle Orient on a Shared SpindleBoth processes can request a spindle orient. If one process requests aspindle orient while the othe...

  • Page 759

    Chapter 30Using a 9/Series Dual--Processing System30-19The Interference Checking feature is designed to help prevent collisions bythe axes of a dual-processing machine.Interference checking provides an area (usually around the cutting tool ortool turret for each process) that defines a boundary t...

  • Page 760

    Chapter 30Using a 9/Series Dual--Processing System30-20Activating Interference CheckingThe interference boundaries for each process are entered into theinterference checking tables. These tables relate the boundaries to specifictool or offset geometries. The system installer selects the number of...

  • Page 761

    Chapter 30Using a 9/Series Dual--Processing System30-21Using Interference Checking to Prevent CollisionsWhen two protected areas are about to collide, the control suspendsmotion, stopping one or both of the processes and preventing a collision.In Example 30.7, process 1 will collide with process ...

  • Page 762

    Chapter 30Using a 9/Series Dual--Processing System30-22The control can store as many as 32 different boundaries for each process.Two separate areas make up each of these boundaries. Both axes areactivated when the boundary is activated through PAL. Figure 30.10illustrates the use of two areas to ...

  • Page 763

    Chapter 30Using a 9/Series Dual--Processing System30-23Important: Your system installer determines the relationship of themachine coordinate systems between processes (relative location of zeropoints and direction of positive travel) in AMP and through hardware.This manual assumes the machine coo...

  • Page 764

    Chapter 30Using a 9/Series Dual--Processing System30-24Important: These areas are measured from the machine coordinate zeropoint to the extremes of the fixture encompassed by the zone when themachine is at home. The machine coordinate system zero point andmachine home are frequently not the same ...

  • Page 765

    Chapter 30Using a 9/Series Dual--Processing System30-25Figure 30.12Protecting Additional Axes with Interference CheckingProcess 2Process 1WZXThough only X and Z define this interference area,some protection is also offered to W since an X or Z collisionwould be detected anytime W would collide. T...

  • Page 766

    Chapter 30Using a 9/Series Dual--Processing System30-263.Press the {INTERF CHECK}softkey to display the interferencechecking data entry screen shown in Figure 30.13.(softkey level 3)ZONELIMITSF1-F9DRLCYCPARAMINTERFCHECKFigure 30.13Interference Checking Data TableSEARCHNUMBERREPLCEVALUEADD TOVALUE...

  • Page 767

    Chapter 30Using a 9/Series Dual--Processing System30-27This boundary number should be the same as the tool geometrynumber (T-word) that will be active when the tool and/or fixture isbeing controlled. Refer to your system installer’s documentation fordetails on which tool or fixture corresponds ...

  • Page 768

    Chapter 30Using a 9/Series Dual--Processing System30-28This is a representation of the basic format for modifying the tables.G10 L{ } P__ X___ Z___ I___ K___;56Where :Is :L(5-6)The definition of which area in the table is being modified.L5 -Modifies the Area 1 valuesL6 -Modifies the Area 2 values...

  • Page 769

    Chapter 30Using a 9/Series Dual--Processing System30-29Example 30.9Resulting Boundary from Example 30.8MachineHomeProcess 1Area 1Area 2+X+ZProcess 1MachineCoordinateSystem Zero Point(Both Processes)19”15”11”18.5”13”19.5”23”12608-IThe control can save all of the information that is e...

  • Page 770

    Chapter 30Using a 9/Series Dual--Processing System30-302.Press the {PRGRAM PARAM}softkey.(softkey level 2)PRGRAMPARAMAMPDEVICESETUPMONI-TORTIMEPARTSPTOMSI/OEM3.Press the {INTERF CHECK}softkey to display the interferencechecking data entry screen as shown in Figure 30.13.(softkey level 3)ZONELIMIT...

  • Page 771

    Chapter 30Using a 9/Series Dual--Processing System30-31Figure 30.14Backup Interference Boundary ScreenTOPORT ATOPORT BTOFILESTORE TO BACKUPINTERFERENCE TABLE5.Determine the destination for the G10 program:To Send the G10 Program To:Press This Softkey:Go to Step:peripheral attached to port A{TO PO...

  • Page 772

    Chapter 30Using a 9/Series Dual--Processing System30-32Your system installer can configure an axis to be shared by differentprocesses. With this feature multiple processes can execute part programcommands or perform manual operations on the same shared axis.A shared axis can not be commanded by m...

  • Page 773

    Chapter 30Using a 9/Series Dual--Processing System30-33Block RetraceAny part program blocks prior to an axis process switch can not beretraced. If you attempt to retrace beyond the point that an axis switchoccurred, the control generates an error. Also an axis process switch cannot be performed i...

  • Page 774

    Chapter 30Using a 9/Series Dual--Processing System30-34The system installer determines what axes are shared and how a sharedaxis is changed from process to process. Using AMP and PAL the systeminstaller determines the process for a shared axis at power up, control reset,and E-Stop reset. Refer to...

  • Page 775

    Chapter 30Using a 9/Series Dual--Processing System30-35Your system installer performs the majority of set up operations in PALand AMP to define a shared axis configuration. This section coversoperations you should perform on the control to properly operate theshared axis.Setup TablesWhen assignin...

  • Page 776

    Chapter 30Using a 9/Series Dual--Processing System30-36You can not change the offset for an axis that is not currently assigned tothe process through a part program (G52, and G92). You can howeverchange coordinate system tables without the shared axis being in theprocess using PAL or by manually ...

  • Page 777

    Chapter 30Using a 9/Series Dual--Processing System30-37Example 30.10Changing Processes with Tool OffsetsProcess OneActivates this ToolProcess TwoActivates this ToolShared AxisT1010;(controls shared axis)T000;Process one activates tool offset on shared axis as defined in AMP(delayed/immediate shif...

  • Page 778

    Chapter 30Using a 9/Series Dual--Processing System30-38Figure 30.15Dual- Axis ConfigurationAxis 1Lead screwServomotorAxis 2Lead screwServomotorEncoderDual Axes - two completely separateaxes responding to the sameprogramming commands.EncoderThe 9/Series control supports two groups of dual axes. Th...

  • Page 779

    Chapter 30Using a 9/Series Dual--Processing System30-39Coupling/Decoupling is a dual group function. All axes must be in thedual groups default process before they can be either coupled or decoupled.When a coupling or decoupling occurs a re-setup occurs of any partprogram blocks read into the con...

  • Page 780

    Chapter 30Using a 9/Series Dual--Processing System30-40Other restrictions are as follows:If the dual- axis is currently:Then:performing a manual motion (includingcontinuous, incremental, or handwheel jog,homing, jog on the fly, or angled jogs)the request to decouple that axis is ignored until the...

  • Page 781

    Chapter 30Using a 9/Series Dual--Processing System30-41An axis that is decoupled from its dual group can have an integrand letterassigned to it in AMP by the system installer. This integrand is used withthat axes originally assigned AMP axis name to perform functions such ascircular interpolation...

  • Page 782

    Chapter 30Using a 9/Series Dual--Processing System30-42

  • Page 783

    AppendixAA-1Softkey TreeThis appendix explains softkeys and includes maps of the softkey trees.We use the term softkey to describe the row of 7 keys at the bottom of theCRT. The function of each softkey is displayed on the CRT directly abovethe softkey. Softkey names are shown in this manual betw...

  • Page 784

    Softkey TreeAppendix AA-2For example :(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTWhen softkey level 1 is reached, the previous set of softkeys is displayed.Press the continue softkey {Þ } to display the remaining softkey functionson softkey level 1.(softkey level 1)FRON...

  • Page 785

    Softkey TreeAppendix AA-3(softkey level 1)PRGRAMMANAGEOFFSET MACROPARAMPRGRAMCHECKSYSTEMSUPORTFRONTPANELERRORMESAGEPASS-WORDSWITCHLANGIf you want to:Press:Edit, activate, or copy a program from a peripheral or control memory{PRGRAM MANAGE}Display or enter tool offset data, the work coordinate sys...

  • Page 786

    Softkey TreeAppendix AA-4PRGRAMA B STARGETD T GAXISSELECTM CODESTATUSPRGRAMA L LD T GAXIS POSITION DISPLAY FORMAT SOFTKEYSG CODESTATUSSPLITON/OFFNOTE: The first 4 softkeys (from PRGRAM to DTG) toggle between smalland large screen display.

  • Page 787

    Softkey TreeAppendix AA-5see page A-14see page A-13WITH POWER UP (AXIS POSITION) DISPLAY SCREENPRGRAMMANAGEOFFSETMACROPARAMPRGRAMCHECKSYSTEMSUPORTFRONTPANELERRORPASS-WORDSWITCHLANGMESAGETHE FUNCTION SELECT SOFTKEYS LEVEL 1PAL Display Page Option: Five softkeys available on thirdscreen. Five addit...

  • Page 788

    Softkey TreeAppendix AA-6level 1level 2level 3level 4PRGRAMMANAGEACTIVEPRGRAMEDITPRGRAMRESTRTPRGRAMDISPLYPRGRAMCOPYPRGRAMVERIFYPRGRAMPRGRAMCOMENTDELETEPRGRAMRENAMEPRGRAMINPUT.DEVICEREFORMMEMORYEXECQUITEXITMEM TOPORT APORT BFROM ATO MEMMEM TOFROM BTO MEMMEM TOMEMVERIFYPORT AVERIFYPORT BVERIFYMEMOR...

  • Page 789

    Softkey TreeAppendix AA-7OFFSET (Lathe & Mill)level 1level 2level 3level 4level 5OFFSETWORKCO-ORDWEARTOOLTOOLGEOMETTOOLMANAGERANDOMCOORDROTATEBACKUPOFFSETREPLCEVALUEADD TOVALUEINCH/METRICRADI/DIAMSEARCHNUMBERREPLCEVALUEADD TOVALUEACTIVEOFFSETMORE.OFFSETMEAS-UREINCH/METRICRADI/DIAMTOOLDIRTOOLD...

  • Page 790

    Softkey TreeAppendix AA-8OFFSET (Grinder)level 1level 2level 3level 4level 5OFFSETWORKCO-ORDGEOMWHEELRADIUSTABLEDRESSERTABLECOORDROTATEBACKUPOFFSETREPLCEVALUEADD TOVALUEINCH/METRICRADI/DIAMSEARCHNUMBERREPLCEVALUEADD TOVALUECHANGEOFFSETMORE.OFFSETMEAS-UREINCH/METRICRADI/DIAMREPLACEVALUEADD TOVALUE...

  • Page 791

    Softkey TreeAppendix AA-9MACRO PARAMlevel 1level 2level 3MACROPARAMLOCALPARAMCOM-1PARAMCOM-2APARAMCOM-2BPARAMSEARCHNUMBERREFRSHSCREENSEARCHNUMBERSEARCHNUMBERREPLCEVALUEZEROVALUE0 ALLVALUESREFRSHSCREEN0 ALLVALUESREFRSHSCREENREPLCEVALUEZEROVALUEREPLCENAMECLEARALL NMNAMECLEARSHAREDPARAM

  • Page 792

    Softkey TreeAppendix AA-10SELECTPRGRAMQUICKCHECKSTOPCHECKGRAPHSYNTAXONLYCLEARGRAPHMACHININFOZOOMPRGRAM CHECKlevel 1level 2level 3level 4T PATHGRAPHPRGRAMCHECKWINDOWT PATHDISABLZOOMBACKGRAPHSETUPDEFALTPARAMSAVEPARAMlevel 5ACTIVEPRGRAMDE-ACTPRGRAM

  • Page 793

    Softkey TreeAppendix AA-11SUPORTSYSTEMlevel 1level 2level 3level 4level 5PRGRAMAMPDEVICEZONELIMITSF1-F9BACKUPAMPSAVECHANGEREPLCEADD TOMOREUPDATEQUITSEARCHYESNOSYSTEM SUPPORTPARAMSETUPREVERSHOMEAXISCALIBSERVOSPNDLTOTOAXISPARAMPATCHAMPUPDATEBACKUPUPLD/DWNLDCOPYDEFLTSVALUEVALUELIMITS& EXITERRORC...

  • Page 794

    Softkey TreeAppendix AA-12SUPORTSYSTEMlevel 1level 2level 3level 4level 5MONI--TIMESETDATEED PRTINFORECVSYSTEM SUPPORTPARTSPTOMSI/OEM@STARTSTOPSINGLEREPEATRINGI/OREMOTEI/OFASTI/OAXISMONITORSERIALI/OENTERMESAGESTOREBACKUPAXISPORT ARECVPORT BXMITPORT APORT BXMIT@ = AXIS NAMEXMITXMITSETTIMETORSTARTS...

  • Page 795

    Softkey TreeAppendix AA-13level 1level 2level 3level 4FRONTPANELPRGRAMEXECSETZEROJOGAXES+JOGAXES--JOGAXISBLOCKRETRCEJOGRETRCTCYCLESTARTCYCLESTOPJOGJOGAXES+AXES--FRONT PANELERROR MESAGElevel 1level 2ERRORMESAGEERRORLOGCLEARACTIVEACTIVEERRORSTIMESTAMPSFULLMESAGEThis softkey toggles between [TIME ST...

  • Page 796

    Softkey TreeAppendix AA-14PASSWORDlevel 1level 2level 3UPDATE& EXIT01(NAME)02(NAME)03(NAME)04(NAME)UPDATE& EXIT05(NAME)06(NAME)07(NAME)08(NAME)STOREBACKUPACCESSCONTRLPASS-WORD(NAME) = PASSWORD NAME

  • Page 797

    Softkey TreeAppendix AA-15PRGRAMACTIVElevel 2level 3level 4level 5level 6DE-ACTPRGRAMSEARCHMID STPRGRAMT PATHGRAPHT PATHDISABLTIMEPARTSSETTIMESETDATEED PRTINFONSEARCHOSEARCHEOBSEARCHSLEWSTRINGSEARCHSEQ #SEARCHSTRINGSEARCHDEFALTPARAMSAVEPARAMFORWRDREVRSETOP OFPRGRAMCANCELEXITFORWRDREVRSETOP OFPRGR...

  • Page 798

    Softkey TreeAppendix AA-16see page A-17level 2level 3level 4level 5EDITPRGRAMMODIFYINSERTBLOCKDELETEBLOCKTRUNCDELETECH/WRDEXITEDITORSTRINGSEARCHRENUMPRGRAMMERGEPRGRAMQUICKVIEWCHAR/WORDDIGITZEFORWRDREVRSETOP OFPRGRAMBOT OFPRGRAMALLONLY NEXECLINEARCIRCLE3 PNTCIRCLETANGNTMODESELECTSTOREEND PTEDIT &a...

  • Page 799

    Softkey TreeAppendix AA-17QUICK VIEWlevel 3level 4level 5level 6QUICKVIEWQPATH+PROMPTG CODEPROMTMILLPROMPTPLANESELECTSELECTSETG17G18G19STOREsee page A-18QUICKVIEWQPATH+PROMPTG CODEPROMTDRILLPROMPTPLANESELECTSELECTSETG17G18G19STORELATHEPROMPTMILLLATHE

  • Page 800

    Softkey TreeAppendix AA-18QPATH+ PROMPTlevel 4level 5level 6QPATH+CIRANG PTCIRCIRANGANGCIR PT2ANGPT2PT R2ANGPT C2ANG2PT C2PT 2R3PT2R2ANG2PT 2C3PT2C2ANG2PT RC3PT RC2ANG2PT CR3PT CRSTORE2ANGPT RPROMPTPTEND OF APPENDIX

  • Page 801

    AppendixBB-1Error and System MessagesThis appendix serves as a guide to error and system messages that canoccur during programming and operation of the 9/Series control. We listedthe messages in alphabetical order along with a brief description.Important: To display both active and inactive messa...

  • Page 802

    Error and System MessagesAppendix BB-2MessageDescription22MB RAM IS BAD/MISSINGThe control has discovered the RAM SIMMs for the two megabyte extended storage option areeither damaged or missing. The RAM SIMMs must be installed or replaced. Contact your AllenBradley sales representative for assist...

  • Page 803

    Error and System MessagesAppendix BB-3MessageDescriptionAMP WAS MODIFIED BY PATCH AMP UTILITYThis message always appears after changes have been made to AMP using the patch AMPutility. Its purpose is to remind the user that the current AMP has not been verified by across-reference check normally ...

  • Page 804

    Error and System MessagesAppendix BB-4MessageDescriptionAXIS INVALID FOR G24/G25The programmed axis was not AMPed for software velocity loop operation, and can not be usedin a G24 or G25 block. To use these features the axis programmed must be configured fortachless operation (or be a digital ser...

  • Page 805

    Error and System MessagesAppendix BB-5MessageDescriptionBAD RAM DISC SECTOR CHECKSUM ERRORA RAM disk sector error was detected during the RAM checksum test at power-up. Attempt topower-up again. If the error remains, contact Allen-Bradley customer support services.BAD RECORD IN PROGRAMThis indica...

  • Page 806

    Error and System MessagesAppendix BB-6MessageDescriptionCANNOT COPYThe requested copying task cannot be performed due to an internal problem in the file or RAMdisk. Contact Allen-Bradley customer support service.CANNOT DELETE - OPEN PROGRAMThe selected program is either active or open for editing...

  • Page 807

    Error and System MessagesAppendix BB-7MessageDescriptionCANNOT RENAMEWhen performing a rename of a program name, the new program name has not been correctlyentered. The format is OLD PROGRAM NAME,NEW PROGRAM NAME.CANNOT REPLACE START POINTAn illegal attempt was made to change the axis calibration...

  • Page 808

    Error and System MessagesAppendix BB-8MessageDescriptionCHARACTERS MUST FOLLOW WILDCARDYou have used incorrect search string syntax in the PAL search monitor utility.CHECKSUM ERROR IN FILEThe file (AMP, PAL) being downloaded from a storage device has a checksum error. The filecannot be used.CIRCL...

  • Page 809

    Error and System MessagesAppendix BB-9MessageDescriptionCPU #2 HARDWARE ERROR #4The 68030 main processor has detected an illegal address. Consult Allen-Bradley customersupport services (9/290 only).CPU #2 HARDWARE ERROR #6The 68030 main processor has detected a privilege violation. Consult Allen-...

  • Page 810

    Error and System MessagesAppendix BB-10MessageDescriptionCYLIND/VIRTUAL CONFIGURATION ERRORAn axis configuration error was detected by the control when cylindrical interpolation or end facemilling was requested in a program block. Some examples would include:A cylindrical/virtual axis is named sa...

  • Page 811

    Error and System MessagesAppendix BB-11MessageDescriptionDEPTH PROBE TRAVEL LIMITThe adaptive depth probe has moved to its AMPed travel limit. Note the value entered in AMPis the adaptive depth probe deflection from the PAL determined probe zero point. It may not bethe actual total probe deflecti...

  • Page 812

    Error and System MessagesAppendix BB-12MessageDescriptionDRESSER WARNING LIMIT REACHEDThe axis specified as the dresser axis has been dressed smaller than the dresser warning limitvalue as specified on the dresser status page.DRILL AXIS CONFIGURATION ERRORThe drilling axis is not a currently conf...

  • Page 813

    Error and System MessagesAppendix BB-13MessageDescriptionENCODER QUADRATURE FAULTAn error has been detected in the encoder feedback signals. Likely causes are excessive noise,inadequate shielding, poor grounding, or encoder hardware failure.END OF FILEWhen transferring a file over the serial port...

  • Page 814

    Error and System MessagesAppendix BB-14MessageDescriptionEXTRA KEYBOARD OR HPG ON I/O RINGThe control detected a keyboard or HPG on the 9/Series fiber optic ring that was not configuredas a ring device. The I/O ring will still function and the control will NOT be held in E-Stop. Youmay also use t...

  • Page 815

    Error and System MessagesAppendix BB-15MessageDescriptionFLASH SIMMS CONTAIN INVALID DATAFlash SIMMs have become corrupted probably from a communication error during a systemupdate. Retry the system executive update utility. If the situation persists, contactAllen--Bradley support.FLASH SIMMS U10...

  • Page 816

    Error and System MessagesAppendix BB-16MessageDescriptionGRAPHICS ACTIVE IN ANOTHER PROCESSGraphics can only be active in one process at a time. You must turn graphics off in one processbefore you can activate them in another process.HHARD STOP ACTIVATION ERRORAn attempt was made to (G24) hard st...

  • Page 817

    Error and System MessagesAppendix BB-17MessageDescriptionHIPERFACE PASSWORD FAILUREDuring the SINCOS device’s alignment procedure, the logic used to set the passwords detectsan incorrect password. A section of the code will repeatedly attempt various combinations ofeach of the passwords to corr...

  • Page 818

    Error and System MessagesAppendix BB-18MessageDescriptionILLEGAL DUAL CONFIGURATIONBoth dual master axes names have the same letter OR when assigning dual groups in AMP,dual groups must be assigned in contiguous order, starting with group 1, 2, 3, 4, and 5. You cannot assign axes to dual group 3 ...

  • Page 819

    Error and System MessagesAppendix BB-19MessageDescriptionINCOMPATIBLE TOOL ACTIVATION MODESThis message is displayed and the control is held in E-Stop at power up when the tool geometryoffset mode is “Immediate Shift/Immediate Move”and the tool wear offset mode is “ImmediateShift/Delay Move...

  • Page 820

    Error and System MessagesAppendix BB-20MessageDescriptionINVALID CHECKSUM DETECTEDThis error is common for several different situations. Most typically it results when writing orrestoring invalid data to flash memory. For example if axis calibration data is being restored toflash and there was an...

  • Page 821

    Error and System MessagesAppendix BB-21MessageDescriptionINVALID FIXED DRILLING AXISThe axis selected as the drilling axis is an invalid axis for a drilling application.INVALID FORMAT SPECIFIED IN B/DPRNT CMDImproper format was used in the paramacro command (BPRNT or DPRNT) that outputs data toa ...

  • Page 822

    Error and System MessagesAppendix BB-22MessageDescriptionINVALID PROGRAM NUMBER (P)A program number called by a sub-program or paramacro call is invalid. A P-word that calls asub-program or paramacro can only be an all-numeric program name as many as 5 digits long.The O-word preceding the numeric...

  • Page 823

    Error and System MessagesAppendix BB-23MessageDescriptionINVALID TOOL LENGTH OFFSET NUMBERAn attempt was made to enter a tool length offset number in the tool life management table thatis larger than the maximum offset number allowed. If the tables are being loaded by a G10program, the length off...

  • Page 824

    Error and System MessagesAppendix BB-24MessageDescriptionLARGER MEMORY - REFORMATThis message typically occurs after a new AMP or PAL has just been downloaded to the control.There is now more memory available for the RAM disk, but you need to reformat to use it. Ifdesired, you do not have to refo...

  • Page 825

    Error and System MessagesAppendix BB-25MessageDescriptionMAXIMUM BLOCK NUMBER REACHEDA renumber operation was performed to renumber block sequence numbers (N-words), and thecontrol has exceeded a block number of N99999. Either the program is too large to renumber,or the parameters for the first s...

  • Page 826

    Error and System MessagesAppendix BB-26MessageDescriptionMINIMUM RPM LIMIT AUXILIARY SPINDLE 2The commanded aux spindle 2 speed requested by the control is less than the AMPed minimumaux spindle 2 speed for the current gear being used. This requires a gear change operation or achange in the progr...

  • Page 827

    Error and System MessagesAppendix BB-27MessageDescriptionMISSING I/O RING DEVICEThe I/O assignment file that was compiled and downloaded with PAL defines an I/O ring devicethat is not physically present in the I/O ring. Verify that all device address settings are correct.MISSING INTEGRAND/RADIUS ...

  • Page 828

    Error and System MessagesAppendix BB-28MessageDescriptionMULTIPLE FUNCTIONS NOT ALLOWEDMultiple functions are not allowed.MULTIPLE SPINDLE CONFIGURATION ERROREach multiple spindle must have a servo board identified in AMP to indicate to which board thespindle is connected. The spindle must be inc...

  • Page 829

    Error and System MessagesAppendix BB-29MessageDescriptionNNEED SHADOW RAM FOR ONLINE SEARCHYour system contains the DH+ module and you have not installed the extra RAM SIMMS thatare required to run the PAL online search monitor with the DH+ module installed. You must buyadditional RAM for a syste...

  • Page 830

    Error and System MessagesAppendix BB-30MessageDescriptionNO PROGRAM TO RESTARTThere is no program to restart. The previous program was either completed or cancelled.NO RECIPROCATION DISTANCEA reciprocation interval of zero (0) was programmed for a grinder reciprocation fixed cycle.NO RECIPROCATIO...

  • Page 831

    Error and System MessagesAppendix BB-31MessageDescriptionOOBJECT NOT FOUND IN PROGRAMThe object you are searching for in the search monitor utility does not exist in the currentmodule, or does not exist in the program in the direction you are searching.OCI ETHERNET CARD NOT INSTALLEDAn OCI dual--...

  • Page 832

    Error and System MessagesAppendix BB-32MessageDescriptionOVER SPEED IN POCKET CYCLEThe programmed feedrate for an irregular pocket cycle (G89) was too high for the cycle to keepup. The part program stops at the endpoint of the block in which the error occurred. The cyclemust be executed with a lo...

  • Page 833

    Error and System MessagesAppendix BB-33MessageDescriptionPAL SOURCE REV. MISMATCH -- CAN’T MONITORPAL source code in the control does not match the revision of the CNC executive. The PALcode may execute if all of the PAL system flags exist but the monitor cannot be used.PAL USING MEMORY - REFOR...

  • Page 834

    Error and System MessagesAppendix BB-34MessageDescriptionPOCKET IS PART OF CUSTOM TOOLAn attempt was made to assign a tool to a tool pocket that is already used by a custom tool.Custom tools are assigned to tool pockets that are shown with an XXXX next to the pocketnumber on the random tool table...

  • Page 835

    Error and System MessagesAppendix BB-35MessageDescriptionPROGRAM NOT FOUNDThe program cannot be located in memory. Check to make sure the program name wascorrectly entered.PROGRAM OPEN FOR EDIT IN ANOTHER PROCESSOn a dual-processing system, you cannot edit a program that is active in another proc...

  • Page 836

    Error and System MessagesAppendix BB-36MessageDescriptionRECIP AXIS IN WRONG PLANEThe reciprocation axis specified in a G81 or a G81.1 programming block is not in the currentlyselected plane.RECIP AXIS NOT PROGRAMMEDNo reciprocation axis was specified in a G81 or a G81.1 programming block.RECIPRO...

  • Page 837

    Error and System MessagesAppendix BB-37MessageDescriptionREMOTE I/O USER FAULT OCCURREDThe RIO module detected that the user fault bit was set. The interboard communications faultLED is flashing.REMOTE I/O WATCHDOG TIMEOUTThe watchdog mechanism on the RIO module timed out, indicating that the RIO...

  • Page 838

    Error and System MessagesAppendix BB-38MessageDescriptionS--CURVE OPTION NOT INSTALLEDAn attempt was made to select S--Curve Acc/Dec (G47.1) when the S--Curve option bit was setto false. Make sure your system includes the S--Curve option.S NOT LEGAL PROGRAMMING AXIS NAMEThis is displayed at power...

  • Page 839

    Error and System MessagesAppendix BB-39MessageDescriptionSERVO AMP C LOOP GAIN ERROROne of the following AMP parameter errors exist::Current Prop. Gain + Current Integral Gain < 4096orCurrent Prop. Gain - Current Integral Gain > 0.SERVO AMP ERRORThere is an error in one or more of the AMP p...

  • Page 840

    Error and System MessagesAppendix BB-40MessageDescriptionSERVO PROCESSOR OVERLAPThe analog version of the servo sub-system provides fine iteration overlap detection. Thismessage is displayed if the fine iteration software on the DSP does not execute to completion inone fine iteration.SERVO PROM C...

  • Page 841

    Error and System MessagesAppendix BB-41MessageDescriptionSPINDLE IS CLAMPEDAn attempt was made to program a block containing a spindle code other than an M05 while thePAL servo clamp request flag for the spindle was set.SPINDLE MODES INCOMPATIBLEAn attempt was made to enter virtual mode when the ...

  • Page 842

    Error and System MessagesAppendix BB-42MessageDescriptionSYSTEM MODULE GROUND FAULTThe 1394 system module has detected a ground fault. The system generates a ground faultwhen there is an imbalance in the DC bus of greater than 5A. This drive error can be caused byincorrect wiring (verify motor an...

  • Page 843

    Error and System MessagesAppendix BB-43MessageDescriptionTHREAD LEAD IS ZERONo thread lead has been programmed in a block that calls for thread cutting. Thread lead isprogrammed with either an F- or an E-word.THREAD PULLOUT DISTANCE TOO LARGEThe programmed threading pullout distance is larger tha...

  • Page 844

    Error and System MessagesAppendix BB-44MessageDescriptionTOO MANY NONMOTION CHAMFER/RADIUS BLOCKSToo many non-motion blocks separate the first tool path that determines the chamfer or radiussize (programmed with a ,R or ,C) from the second tool path. A maximum number ofnon-motion blocks is set in...

  • Page 845

    Error and System MessagesAppendix BB-45MessageDescriptionUNABLE TO SYNCH IN CURRENT MODEThe control can not perform the request to synchronize spindles. Possible causes are:synchronization is already active; virtual/cylindrical programming or a threading operation isactive on the primary or follo...

  • Page 846

    Error and System MessagesAppendix BB-46MessageDescriptionZZ-WORD CANNOT BE GREATER THAN R-WORDThe depth (Z-word) of a pocket formed using a G88.5 and G88.6 hemispherical pocket cyclecannot be greater than the radius (R-word) of that pocket.ZONE 2 PROGRAM ERRORThe next block in the program or MDI ...

  • Page 847

    AppendixCC-1G-code TablesThis appendix lists the G-codes for 9/Series turning center. This table ispresented numerically by G--code system B along with a brief descriptionof their use. These G-codes are discussed in detail in the sections withinthis manual that refer to their specific use.The gro...

  • Page 848

    G-code TablesAppendix CC-2ATypeFunctionModalCBG12.121Spindle 1 ControllingModalG12.2Spindle 2 ControllingG12.3Spindle 3 ControllingG1300QuickPath Plus (Use First Intersect.)NonmodalG1300QuickPath Plus (Use Second Intersect.)NonmodalG1419Scaling (Disable)ModalG14.1Scaling (Enable)ModalG1515Virtual...

  • Page 849

    G-code TablesAppendix CC-3ATypeFunctionModalCBG4523Disable Spindle SynchronizationModalG4623Set Spindle Positional SynchronizationModalG46.1Set Active Spindle Speed SynchronizationG4724Linear Acc/Dec in All ModesG47.124S--Curve Acc/Dec for Positioning and Exact Stop ModeG47.9Infinite Acc/Dec (No ...

  • Page 850

    G-code TablesAppendix CC-4ATypeFunctionModalCBG75G75G77O.D. and I.D. Grooving CycleG76G76G78O.D. and I.D. Multi-Pass Threading RoutineG8009Cancel or end fixed cycleModalG81Drilling cycle (no dwell, rapid out)G82Drilling cycle (dwell, rapid out)G83Deep hole peck drilling cycleG83.1Deep hole peck d...

  • Page 851

    AppendixDD-1Allen-Bradley 7300 Series CNC TapeCompatibilityThe 7300 Series CNC tape compatibility feature has been developed forcustomers with an existing library of standard 7320 and 7360 CNC tapes.This feature allows those 7300 tapes to be read and executed by thecontrol. If desired, these 7300...

  • Page 852

    Allen-Bradley 7300 Series CNCTape CompatibilityAppendix DD-2Table D.AG-codesG-code:Function:G00Positioning modeG01Linear interpolationG02Circular interpolation CWG03Circular interpolation CCWG04DwellG21Linear interpolation with delayG22/G23Circular interpolation with delayG2811st auto threading c...

  • Page 853

    Allen-Bradley 7300 Series CNCTape CompatibilityAppendix DD-3G28 and G29 Automatic Thread Cutting or Roughing CycleG28 and G29 are not standard 7300s Lathe G-codes, but have beenprovided to enable automatic thread cutting or roughing. Both G28 andG29 are used for the Automatic Thread Cutting cycle...

  • Page 854

    Allen-Bradley 7300 Series CNCTape CompatibilityAppendix DD-4The format for the G28 block is:G28__D__X__Z__FWhere: Specifies:Dfinal threading depth or roughing depth. For Absolute Programming mode (G90), thisparameter is programmed as an X axis position. For Incremental Programming mode(G91), this...

  • Page 855

    Allen-Bradley 7300 Series CNCTape CompatibilityAppendix DD-5The format for the G29 block is:G29__D__K__I__Z__L__FWhere: Specifies:Dreturn pass clearance, which is the distance between the initial work surface and thestarting point. D value must always be programmed as an incremental distance,rega...

  • Page 856

    Allen-Bradley 7300 Series CNCTape CompatibilityAppendix DD-6CAUTION: The feedrate of any thread cutting pass islead-limited to 100 inches per minute (IPM). If the values ofthe programmed thread lead and the currently active spindlespeed generate a feedrate that exceeds 100 IPM, the controlautomat...

  • Page 857

    Allen-Bradley 7300 Series CNCTape CompatibilityAppendix DD-7Table D.B lists all of the 7300 M-codes that the control can execute in7300 mode. See the System 7360 Programming Manual for details onthese M-codes and their operation.Table D.BM-codesM-code:Function:M00Program stopM01Optional program s...

  • Page 858

    Allen-Bradley 7300 Series CNCTape CompatibilityAppendix DD-8Tool Length OffsetWhen the control is in 7300 mode, tool length offsets are activated in thesame manner as on the 7300. The control supports 1- through 4-digitT-words, and through AMP configuration, you have the flexibility ofspecifying ...

  • Page 859

    Allen-Bradley 7300 Series CNCTape CompatibilityAppendix DD-9The control has two offset tables: geometry and wear table. The sum fromthese two tables is used to generate tool length data when the tool offsetnumber is programmed. When in 7300 mode, the active offset is alsocomputed as the sum of th...

  • Page 860

    Allen-Bradley 7300 Series CNCTape CompatibilityAppendix DD-10Pattern RepeatA pattern repeat is a series of blocks of information repeated a specifiednumber of times for a specified function. A pattern repeat is called in 7300mode with the following format:(CP, name, r)#where:Name:Indicates:CPa pa...

  • Page 861

    Allen-Bradley 7300 Series CNCTape CompatibilityAppendix DD-11Executing 7300 Part ProgramsThe system installer has to write PAL program for the control to execute in7300 tape compatibility mode. Refer to the PAL manual for details.The control allows the Power-Turn-On mode (PTO) of the control to b...

  • Page 862

    Allen-Bradley 7300 Series CNCTape CompatibilityAppendix DD-12The main program, which has the pattern repeat call block “(CP, name, r),”can be executed from tape or from the control memory. However, if youwant to make minor editing to your main program, you must copy theprogram into the contro...

  • Page 863

    Allen-Bradley 7300 Series CNCTape CompatibilityAppendix DD-13Table D.C (continued)9/Series Lathe G-codes Available in 7300 ModeG-code:Description:G55Preset work coordinate system 2G56Preset work coordinate system 3G57Preset work coordinate system 4G58Preset work coordinate system 5G59Preset work ...

  • Page 864

    Allen-Bradley 7300 Series CNCTape CompatibilityAppendix DD-14

  • Page 865

    9/Series PAL Reference ManualIndex (General)9/Series LatheIndexOperation and Programming ManualiNumbers7300 Series CNC TapeCompatibility9/240 G--Codes Applicable, D-12Automatic MultiPass Roughing, D-3Automatic Thread Cutting (G28, G29), D-3Features Not Supported on 9/240, D-13G--Code Consideratio...

  • Page 866

    9/Series PAL Reference ManualIndex (General)9/Series LatheIndexOperation and Programming ManualiiCC Axis, Virtual, 17-13C-Word, 10-21Cancel Fixed Cycle (G80), 26-8Casting/Forging Roughing Cycle Routine (G75), 24-29Chamfering and Corner Radius, 16-1Changing Languages, 8-23Changing ParametersAuto E...

  • Page 867

    9/Series PAL Reference ManualIndex (General)9/Series LatheIndexOperation and Programming ManualiiiDisplaying PositionABS, 8-6ABS (Large Display), 8-7absolute (Small Display), 8-7ALL, 8-19distance to go (Small Display), 8-13DTG, 8-12DTG (Large Display), 8-13G Code Status, 8-20M Code Status, 8-16PR...

  • Page 868

    9/Series PAL Reference ManualIndex (General)9/Series LatheIndexOperation and Programming ManualivChanging and Inserting, 5-8Entering Characters and Blocks, 5-7Erasing Characters and Blocks, 5-11EIA (RS-244), 9-7Emergency Stop Operations, 2-12, 2-22Emergency Stop Reset, 2-12, 2-22End Face Milling,...

  • Page 869

    9/Series PAL Reference ManualIndex (General)9/Series LatheIndexOperation and Programming ManualvG31, 27-2G31.1, 27-2G31.2, 27-2G31.3, 27-2G31.4, 27-2G33, 25-6G34, 25-12G36, 18-19G36.1, 18-19G37, 27-3G37.1, 27-3G37.2, 27-3G37.3, 27-3G37.4, 27-3G39, 21-9G39.1, 21-9G40, 21-4G41, 21-4G42, 21-4G47, 18...

  • Page 870

    9/Series PAL Reference ManualIndex (General)9/Series LatheIndexOperation and Programming ManualviGroups, for dual axes, 30-38HHardware Installed, 8-37Hardware Overtravel, 12-2Hole Machining Axes, 26-4Homing a Dual Axis, 19-4Homing, Manual Machine, 4-9Homing, the AxisAutomatic Homing, 14-12Automat...

  • Page 871

    9/Series PAL Reference ManualIndex (General)9/Series LatheIndexOperation and Programming ManualviiMM --Code Status Display, 8-16M Codes, M00 program stop, 28-42M-Codes, 10-27M00 Program Stop, 10-30M01 Optional Program Stop, 10-30M02 End of Program, 10-30M03 Primary Spindle Clockwise, 17-12M04 Pri...

  • Page 872

    9/Series PAL Reference ManualIndex (General)9/Series LatheIndexOperation and Programming ManualviiiOO.D. & I.D. Finishing Routine (G72), 24-35O.D. & I.D. Grooving Cycle (G77), 23-6O.D. & I.D. Multipass Threading Routine (G78), 25-20O.D. & I.D. Roughing Routine (G73), 24-2O-Word Pr...

  • Page 873

    9/Series PAL Reference ManualIndex (General)9/Series LatheIndexOperation and Programming ManualixSingle--Pass Turning Cycles, 22-1Parametric Expressions, 28-2Parity, for communications, 9-6Parking a Dual Axis, 19-3Part Production/Automatic Mode, 7-23Part ProgramError Conditions, I/O, 9-18Inputtin...

  • Page 874

    9/Series PAL Reference ManualIndex (General)9/Series LatheIndexOperation and Programming ManualxProgrammable Zones, 12-1Programming Configuration, 10-6Programming Data and Backing up Tool ManagementTables, 20-22ProgramsInputting from Peripheral, 9-9outputting to peripheral, 9-13verifying against ...

  • Page 875

    9/Series PAL Reference ManualIndex (General)9/Series LatheIndexOperation and Programming ManualxiMoving the Cursor, 5-6Program Search, 7-9Search With Recall, 7-12Select Graph, 8-29Selecting a Part Program Input Device, 7-5Selecting Linear Acc/Dec Modes, Using G47, 18-15Selecting Linear Acc/Dec Va...

  • Page 876

    9/Series PAL Reference ManualIndex (General)9/Series LatheIndexOperation and Programming ManualxiiMERGE PRGRAM, 5-15MID ST PRGRAM, 7-12, 7-25MODIFY INSERT, 5-8MORE LIMITS, 3-22MORE OFFSET, 3-9NCRYPT MODE, 5-45PASSWORD, 2-24PLANE SELECT, 5-27, 5-30, 13-1PRGRAM, 8-1, 8-3PRGRAM CHECK, 7-19, 8-24PRGR...

  • Page 877

    9/Series PAL Reference ManualIndex (General)9/Series LatheIndexOperation and Programming ManualxiiiSynchronizationCoordinating, 30-10Cycle Stop, 30-11M-codes, 30-7MDI Mode, 30-11Multiple Part Programs, 30-7Program Interrupts, 30-11Simple, 30-8With Setup, 30-8Synchronized Spindle, 17-23, 17-24, 17...

  • Page 878

    9/Series PAL Reference ManualIndex (General)9/Series LatheIndexOperation and Programming ManualxivLinear Transition (G39), 21-9Linear Transition (G39), 21-8Machine Home (To/From), 21-49MDI or Manual Motion, 21-47Minimum Block Length, 21-9Non--Motion Blocks, 21-39Overview, 21-1Programming Instruct...

  • Page 879

    Publication 8520--UM511A--EN--P -- November 2000

  • Page 880

x